Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6U7H9

Protein Details
Accession A0A5N6U7H9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-46AVIFFIKKRKSRKEKERSIENGFHydrophilic
NLS Segment(s)
PositionSequence
30-39KKRKSRKEKE
Subcellular Location(s) cyto 7.5, mito 6, cyto_nucl 5.5, plas 4, extr 3, nucl 2.5, pero 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGLLKIALKAILIPIITLLVITVAVIFFIKKRKSRKEKERSIENGFQPPPIVQWVPNQDIQKPVPAAYVSQAHPTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.07
4 0.07
5 0.06
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.05
15 0.12
16 0.17
17 0.23
18 0.32
19 0.43
20 0.53
21 0.64
22 0.74
23 0.78
24 0.83
25 0.84
26 0.85
27 0.81
28 0.77
29 0.73
30 0.64
31 0.6
32 0.5
33 0.43
34 0.34
35 0.28
36 0.22
37 0.19
38 0.18
39 0.12
40 0.18
41 0.23
42 0.26
43 0.3
44 0.31
45 0.29
46 0.33
47 0.33
48 0.33
49 0.29
50 0.26
51 0.24
52 0.23
53 0.23
54 0.22
55 0.26
56 0.21