Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TQT6

Protein Details
Accession A0A5N6TQT6   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MATKTRTIRQRRVDNAKSRYQQRNRRMSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5mito_nucl 12.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MATKTRTIRQRRVDNAKSRYQQRNRRMSSLFLKAFEYCHLCDADMSIKVRLRHNGEIVVFNSNDNWSPTQAQLATYYPKPKQVTWQELAAKYEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.81
4 0.79
5 0.78
6 0.78
7 0.78
8 0.79
9 0.79
10 0.83
11 0.78
12 0.77
13 0.7
14 0.65
15 0.61
16 0.6
17 0.52
18 0.42
19 0.39
20 0.33
21 0.32
22 0.28
23 0.25
24 0.16
25 0.16
26 0.15
27 0.13
28 0.12
29 0.13
30 0.12
31 0.11
32 0.12
33 0.13
34 0.15
35 0.17
36 0.19
37 0.23
38 0.26
39 0.27
40 0.27
41 0.28
42 0.26
43 0.27
44 0.26
45 0.24
46 0.18
47 0.16
48 0.15
49 0.13
50 0.13
51 0.12
52 0.13
53 0.12
54 0.14
55 0.14
56 0.17
57 0.16
58 0.16
59 0.17
60 0.18
61 0.21
62 0.23
63 0.29
64 0.27
65 0.35
66 0.37
67 0.36
68 0.44
69 0.49
70 0.54
71 0.51
72 0.58
73 0.57
74 0.57