Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5MIW9

Protein Details
Accession C5MIW9   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-80RFKFNFFKKENKNKNKNRNKTPPLPPSLHydrophilic
NLS Segment(s)
PositionSequence
60-104KKENKNKNKNRNKTPPLPPSLPPRLPRLPPPPPSSHAQRREVKKK
Subcellular Location(s) mito 11, nucl 8, cyto 6
Family & Domain DBs
KEGG ctp:CTRG_06012  -  
Amino Acid Sequences MPSSGFLFFAVVHGAHTDYITFHTQTAVVNLFIEVSYKQEKKRMKISFFLWFRFKFNFFKKENKNKNKNRNKTPPLPPSLPPRLPRLPPPPPSSHAQRREVKKKFTIFQTIEGKNTSTKKFHLIYIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.08
6 0.11
7 0.13
8 0.13
9 0.12
10 0.13
11 0.13
12 0.13
13 0.16
14 0.14
15 0.11
16 0.1
17 0.1
18 0.1
19 0.09
20 0.1
21 0.07
22 0.09
23 0.16
24 0.18
25 0.2
26 0.27
27 0.33
28 0.37
29 0.47
30 0.51
31 0.48
32 0.5
33 0.52
34 0.55
35 0.52
36 0.51
37 0.46
38 0.4
39 0.39
40 0.36
41 0.35
42 0.32
43 0.35
44 0.4
45 0.37
46 0.46
47 0.53
48 0.62
49 0.69
50 0.73
51 0.78
52 0.8
53 0.88
54 0.9
55 0.89
56 0.88
57 0.88
58 0.85
59 0.83
60 0.83
61 0.8
62 0.76
63 0.7
64 0.63
65 0.6
66 0.61
67 0.58
68 0.5
69 0.49
70 0.48
71 0.47
72 0.52
73 0.52
74 0.52
75 0.54
76 0.57
77 0.55
78 0.53
79 0.56
80 0.58
81 0.59
82 0.58
83 0.6
84 0.62
85 0.67
86 0.75
87 0.77
88 0.75
89 0.73
90 0.73
91 0.7
92 0.68
93 0.68
94 0.6
95 0.61
96 0.62
97 0.56
98 0.52
99 0.48
100 0.43
101 0.39
102 0.42
103 0.39
104 0.33
105 0.34
106 0.38
107 0.39