Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TG27

Protein Details
Accession A0A5N6TG27    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-67RLSKHQLTIKNRHRRCRYNEAEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 6, extr 5, E.R. 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MGSVMMYDHFPQFGLLSLILLCISLINRLLSWILTLSRPMVSTLLRLSKHQLTIKNRHRRCRYNEAEGQWVLYCRCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.08
6 0.07
7 0.07
8 0.05
9 0.04
10 0.05
11 0.05
12 0.06
13 0.06
14 0.06
15 0.07
16 0.08
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.11
31 0.15
32 0.15
33 0.16
34 0.2
35 0.22
36 0.28
37 0.31
38 0.36
39 0.39
40 0.49
41 0.59
42 0.65
43 0.68
44 0.73
45 0.78
46 0.8
47 0.81
48 0.81
49 0.78
50 0.77
51 0.78
52 0.72
53 0.69
54 0.6
55 0.54
56 0.44
57 0.39