Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6TNX6

Protein Details
Accession A0A5N6TNX6    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
83-105AASNKNAKRREAKKKAKATQDGSHydrophilic
140-170DPEAEKEKKARNLKKKLRQARDLRDKKNQGEBasic
NLS Segment(s)
PositionSequence
86-99NKNAKRREAKKKAK
145-165KEKKARNLKKKLRQARDLRDK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MAASNSGITVDATTGERFIPSSLRADGSKRREIRVRPGYRPPEDVELYKNRAAEAWKNRGKTGVPGADPIKSESETGSKATSAASNKNAKRREAKKKAKATQDGSTEGRNVTDIDNWRAPANQKQPEAEKTAAGTEETADPEAEKEKKARNLKKKLRQARDLRDKKNQGESLLPEQLEKVIKIQELVRQLDTLGFDSNGDKKDEPNDKEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.11
6 0.13
7 0.12
8 0.16
9 0.17
10 0.19
11 0.21
12 0.26
13 0.34
14 0.38
15 0.45
16 0.45
17 0.49
18 0.54
19 0.57
20 0.63
21 0.65
22 0.66
23 0.63
24 0.7
25 0.73
26 0.69
27 0.68
28 0.6
29 0.56
30 0.5
31 0.45
32 0.41
33 0.39
34 0.4
35 0.38
36 0.35
37 0.28
38 0.28
39 0.29
40 0.32
41 0.34
42 0.39
43 0.42
44 0.44
45 0.44
46 0.45
47 0.43
48 0.39
49 0.38
50 0.33
51 0.29
52 0.31
53 0.32
54 0.31
55 0.31
56 0.28
57 0.22
58 0.17
59 0.17
60 0.14
61 0.15
62 0.14
63 0.15
64 0.14
65 0.11
66 0.11
67 0.11
68 0.13
69 0.13
70 0.15
71 0.2
72 0.28
73 0.31
74 0.39
75 0.42
76 0.43
77 0.5
78 0.56
79 0.61
80 0.64
81 0.72
82 0.74
83 0.81
84 0.84
85 0.83
86 0.81
87 0.74
88 0.68
89 0.61
90 0.55
91 0.46
92 0.4
93 0.32
94 0.24
95 0.2
96 0.14
97 0.12
98 0.09
99 0.11
100 0.12
101 0.15
102 0.17
103 0.17
104 0.17
105 0.18
106 0.19
107 0.23
108 0.29
109 0.31
110 0.31
111 0.33
112 0.36
113 0.38
114 0.41
115 0.34
116 0.26
117 0.21
118 0.2
119 0.19
120 0.15
121 0.12
122 0.08
123 0.09
124 0.09
125 0.09
126 0.08
127 0.08
128 0.08
129 0.12
130 0.13
131 0.13
132 0.17
133 0.22
134 0.31
135 0.42
136 0.51
137 0.57
138 0.67
139 0.76
140 0.83
141 0.87
142 0.89
143 0.88
144 0.88
145 0.87
146 0.87
147 0.88
148 0.87
149 0.83
150 0.83
151 0.82
152 0.76
153 0.76
154 0.68
155 0.59
156 0.54
157 0.52
158 0.48
159 0.46
160 0.41
161 0.31
162 0.29
163 0.3
164 0.27
165 0.22
166 0.17
167 0.16
168 0.17
169 0.18
170 0.2
171 0.22
172 0.26
173 0.29
174 0.28
175 0.25
176 0.25
177 0.25
178 0.25
179 0.21
180 0.17
181 0.14
182 0.13
183 0.16
184 0.21
185 0.21
186 0.23
187 0.22
188 0.23
189 0.32
190 0.41
191 0.43