Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TKC4

Protein Details
Accession A0A5N6TKC4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
97-116SPTGWSRKMKWPIYKKRVEAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, extr 8, cyto 4, pero 2, mito 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR031348  Helo-like_N  
Pfam View protein in Pfam  
PF17111  Helo_like_N  
Amino Acid Sequences MDPLSIASGVAGLVGLAIQIAPSLHAFFQDVKDAKADVDRYVSEVISLHEVCQQLHVFLKTDAAARDGQFETTQSVLSRTVLSCDECLRELAHMLKSPTGWSRKMKWPIYKKRVEAVIQRLGRYTQVFQFSLTLEGWCVLVNCLFTCSGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.03
8 0.04
9 0.05
10 0.07
11 0.07
12 0.08
13 0.09
14 0.11
15 0.12
16 0.19
17 0.19
18 0.19
19 0.2
20 0.2
21 0.19
22 0.22
23 0.21
24 0.14
25 0.16
26 0.16
27 0.17
28 0.17
29 0.17
30 0.13
31 0.12
32 0.12
33 0.13
34 0.13
35 0.11
36 0.14
37 0.14
38 0.14
39 0.17
40 0.16
41 0.13
42 0.15
43 0.15
44 0.13
45 0.12
46 0.13
47 0.11
48 0.13
49 0.12
50 0.12
51 0.12
52 0.11
53 0.14
54 0.14
55 0.14
56 0.12
57 0.12
58 0.11
59 0.1
60 0.11
61 0.07
62 0.08
63 0.08
64 0.08
65 0.09
66 0.08
67 0.09
68 0.09
69 0.1
70 0.1
71 0.11
72 0.11
73 0.11
74 0.11
75 0.1
76 0.09
77 0.1
78 0.11
79 0.12
80 0.14
81 0.14
82 0.14
83 0.14
84 0.16
85 0.2
86 0.22
87 0.24
88 0.27
89 0.32
90 0.41
91 0.5
92 0.55
93 0.59
94 0.66
95 0.73
96 0.78
97 0.8
98 0.74
99 0.7
100 0.69
101 0.64
102 0.61
103 0.57
104 0.57
105 0.51
106 0.49
107 0.44
108 0.39
109 0.37
110 0.32
111 0.28
112 0.23
113 0.26
114 0.26
115 0.26
116 0.26
117 0.24
118 0.24
119 0.21
120 0.17
121 0.12
122 0.12
123 0.11
124 0.1
125 0.1
126 0.08
127 0.09
128 0.1
129 0.1
130 0.12