Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TG00

Protein Details
Accession A0A5N6TG00    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-68KGKIKIKMIEKKVKKKNKKQTTKQKDPQLVSHydrophilic
NLS Segment(s)
PositionSequence
38-57KGKIKIKMIEKKVKKKNKKQ
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MEPLHSCSLSLFLSLSRSLSLFLGFPLPEYVNQGQIQKGKIKIKMIEKKVKKKNKKQTTKQKDPQLVSLEREDSVELNEQRQNNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.11
5 0.11
6 0.11
7 0.11
8 0.08
9 0.08
10 0.1
11 0.09
12 0.1
13 0.11
14 0.11
15 0.11
16 0.16
17 0.16
18 0.17
19 0.19
20 0.19
21 0.19
22 0.21
23 0.23
24 0.22
25 0.26
26 0.27
27 0.29
28 0.31
29 0.33
30 0.4
31 0.47
32 0.51
33 0.55
34 0.59
35 0.66
36 0.73
37 0.79
38 0.8
39 0.83
40 0.87
41 0.88
42 0.91
43 0.91
44 0.93
45 0.93
46 0.94
47 0.92
48 0.9
49 0.88
50 0.79
51 0.75
52 0.71
53 0.62
54 0.54
55 0.49
56 0.41
57 0.33
58 0.31
59 0.25
60 0.18
61 0.17
62 0.22
63 0.2
64 0.22
65 0.27