Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6TLX5

Protein Details
Accession A0A5N6TLX5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKRKKSSRQPQQPKKKEPLPTTFHydrophilic
NLS Segment(s)
PositionSequence
3-17KRKKSSRQPQQPKKK
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRQPQQPKKKEPLPTTFACLFCNHENSVVVKLDKKLGLGNLSCKVCGQRFQTGINYLSAAVDVYSDWVDACDAVARDTVNRYDDNNAPGLRSNEYTTSTGERDIGDNDVDDYADDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.88
4 0.86
5 0.83
6 0.8
7 0.75
8 0.66
9 0.64
10 0.59
11 0.52
12 0.44
13 0.37
14 0.34
15 0.3
16 0.32
17 0.25
18 0.22
19 0.23
20 0.22
21 0.24
22 0.22
23 0.2
24 0.18
25 0.19
26 0.21
27 0.2
28 0.19
29 0.17
30 0.16
31 0.19
32 0.18
33 0.21
34 0.23
35 0.22
36 0.22
37 0.21
38 0.22
39 0.19
40 0.23
41 0.23
42 0.23
43 0.24
44 0.26
45 0.28
46 0.28
47 0.28
48 0.23
49 0.2
50 0.14
51 0.12
52 0.1
53 0.07
54 0.05
55 0.04
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.06
68 0.07
69 0.07
70 0.08
71 0.1
72 0.12
73 0.12
74 0.13
75 0.14
76 0.18
77 0.21
78 0.22
79 0.24
80 0.22
81 0.21
82 0.24
83 0.24
84 0.23
85 0.22
86 0.22
87 0.2
88 0.24
89 0.24
90 0.23
91 0.26
92 0.24
93 0.23
94 0.22
95 0.2
96 0.18
97 0.19
98 0.18
99 0.15
100 0.14
101 0.14
102 0.13
103 0.12