Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6THM4

Protein Details
Accession A0A5N6THM4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-27TTNPISCEPCRQKKCKCDRLLPICTQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MTTNPISCEPCRQKKCKCDRLLPICTQCTSTSTQNKCVYPESGKRLHNASRAQTCRDRGSAVLGSGADEAGRERVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.85
3 0.85
4 0.82
5 0.81
6 0.83
7 0.84
8 0.82
9 0.79
10 0.74
11 0.66
12 0.58
13 0.51
14 0.41
15 0.33
16 0.3
17 0.3
18 0.32
19 0.32
20 0.4
21 0.42
22 0.42
23 0.42
24 0.4
25 0.35
26 0.31
27 0.35
28 0.33
29 0.35
30 0.35
31 0.35
32 0.37
33 0.39
34 0.4
35 0.39
36 0.39
37 0.42
38 0.44
39 0.48
40 0.49
41 0.49
42 0.46
43 0.44
44 0.39
45 0.3
46 0.33
47 0.3
48 0.25
49 0.22
50 0.18
51 0.18
52 0.16
53 0.16
54 0.09
55 0.07
56 0.08