Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TE46

Protein Details
Accession A0A5N6TE46   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-110RATYNPSRRVQKRRHGFLARIRSRGGRKIIMRRRAKGRKNLSWHydrophilic
NLS Segment(s)
PositionSequence
74-107SRRVQKRRHGFLARIRSRGGRKIIMRRRAKGRKN
Subcellular Location(s) mito 19, nucl 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFGIRCRALIAVRTVSSPVSLSRFTKSIPSTPLRPTISQPSLTQTAFAAPIQSQTRAFSASACLAGKRATYNPSRRVQKRRHGFLARIRSRGGRKIIMRRRAKGRKNLSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.22
4 0.19
5 0.16
6 0.15
7 0.17
8 0.18
9 0.2
10 0.21
11 0.21
12 0.27
13 0.27
14 0.28
15 0.31
16 0.34
17 0.35
18 0.37
19 0.44
20 0.41
21 0.39
22 0.38
23 0.41
24 0.4
25 0.38
26 0.35
27 0.32
28 0.32
29 0.3
30 0.27
31 0.18
32 0.16
33 0.15
34 0.14
35 0.1
36 0.07
37 0.11
38 0.12
39 0.13
40 0.12
41 0.12
42 0.13
43 0.13
44 0.13
45 0.09
46 0.1
47 0.1
48 0.11
49 0.1
50 0.1
51 0.09
52 0.1
53 0.1
54 0.1
55 0.12
56 0.15
57 0.22
58 0.3
59 0.37
60 0.45
61 0.54
62 0.6
63 0.68
64 0.72
65 0.75
66 0.78
67 0.79
68 0.8
69 0.77
70 0.75
71 0.75
72 0.77
73 0.72
74 0.64
75 0.58
76 0.56
77 0.55
78 0.55
79 0.52
80 0.49
81 0.51
82 0.59
83 0.67
84 0.7
85 0.74
86 0.74
87 0.8
88 0.82
89 0.84
90 0.83