Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5M2Y0

Protein Details
Accession C5M2Y0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
71-96ILKAVPKKKMSRARRRKKLYASGNKQHydrophilic
NLS Segment(s)
PositionSequence
75-88VPKKKMSRARRRKK
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ctp:CTRG_00419  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MSLSLRFGAVTSLQESLWGLVPRLPSITIRLGLQNKLGNQQSLPMDERLRELKEKIEESGEAPFMIDNGTILKAVPKKKMSRARRRKKLYASGNKQVHPINNIVRCSACGSVKRSHFMCMNCFAEIRTFLKSLKRKNGLLEEPVNPQSDLNPLDERVIYPGKFETDEQRRLKSKDWVPQREEAGLYNHQEVKHIKKSNKGPVMVKLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.17
5 0.15
6 0.14
7 0.16
8 0.17
9 0.18
10 0.18
11 0.18
12 0.14
13 0.18
14 0.21
15 0.2
16 0.2
17 0.26
18 0.28
19 0.28
20 0.31
21 0.31
22 0.29
23 0.34
24 0.34
25 0.29
26 0.25
27 0.29
28 0.26
29 0.26
30 0.27
31 0.24
32 0.23
33 0.22
34 0.26
35 0.25
36 0.26
37 0.26
38 0.24
39 0.27
40 0.31
41 0.31
42 0.29
43 0.28
44 0.25
45 0.23
46 0.24
47 0.19
48 0.14
49 0.12
50 0.11
51 0.09
52 0.08
53 0.07
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.1
60 0.14
61 0.18
62 0.24
63 0.29
64 0.33
65 0.43
66 0.53
67 0.6
68 0.66
69 0.74
70 0.79
71 0.84
72 0.88
73 0.87
74 0.85
75 0.84
76 0.84
77 0.83
78 0.8
79 0.79
80 0.75
81 0.67
82 0.61
83 0.53
84 0.44
85 0.35
86 0.31
87 0.27
88 0.26
89 0.25
90 0.23
91 0.21
92 0.21
93 0.21
94 0.19
95 0.15
96 0.15
97 0.19
98 0.24
99 0.26
100 0.29
101 0.27
102 0.28
103 0.31
104 0.28
105 0.27
106 0.27
107 0.27
108 0.24
109 0.23
110 0.2
111 0.17
112 0.18
113 0.17
114 0.14
115 0.13
116 0.14
117 0.23
118 0.29
119 0.35
120 0.42
121 0.46
122 0.45
123 0.49
124 0.56
125 0.51
126 0.5
127 0.47
128 0.4
129 0.39
130 0.39
131 0.36
132 0.28
133 0.24
134 0.19
135 0.19
136 0.18
137 0.17
138 0.16
139 0.16
140 0.17
141 0.17
142 0.17
143 0.17
144 0.2
145 0.16
146 0.16
147 0.17
148 0.18
149 0.19
150 0.2
151 0.25
152 0.29
153 0.39
154 0.41
155 0.47
156 0.51
157 0.53
158 0.56
159 0.56
160 0.55
161 0.55
162 0.62
163 0.64
164 0.63
165 0.66
166 0.64
167 0.57
168 0.51
169 0.44
170 0.38
171 0.34
172 0.32
173 0.31
174 0.32
175 0.29
176 0.33
177 0.35
178 0.38
179 0.44
180 0.49
181 0.48
182 0.54
183 0.64
184 0.7
185 0.74
186 0.71
187 0.66