Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6U3V8

Protein Details
Accession A0A5N6U3V8    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-35RNVAISCDECRRRRRRCDGEQTCGPCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
Amino Acid Sequences MPATRTKRGRNVAISCDECRRRRRRCDGEQTCGPCIKRGTQFVKEVEVFVRGRKAKAKSVNADESCPVDTTESAQSANASISTTASPTGVPCEGAETVASDGSDKVANSEPKTGHDSADARQPMTGWSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.58
3 0.59
4 0.6
5 0.57
6 0.62
7 0.65
8 0.67
9 0.73
10 0.81
11 0.82
12 0.85
13 0.89
14 0.88
15 0.86
16 0.84
17 0.78
18 0.71
19 0.65
20 0.54
21 0.47
22 0.4
23 0.38
24 0.35
25 0.38
26 0.41
27 0.42
28 0.47
29 0.44
30 0.46
31 0.41
32 0.36
33 0.29
34 0.26
35 0.21
36 0.17
37 0.23
38 0.19
39 0.21
40 0.26
41 0.29
42 0.32
43 0.4
44 0.45
45 0.43
46 0.48
47 0.55
48 0.49
49 0.47
50 0.4
51 0.33
52 0.28
53 0.23
54 0.17
55 0.1
56 0.09
57 0.1
58 0.11
59 0.1
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.07
66 0.06
67 0.05
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.09
76 0.08
77 0.09
78 0.08
79 0.11
80 0.1
81 0.11
82 0.1
83 0.09
84 0.09
85 0.09
86 0.09
87 0.07
88 0.07
89 0.08
90 0.1
91 0.08
92 0.1
93 0.16
94 0.21
95 0.23
96 0.28
97 0.28
98 0.3
99 0.37
100 0.35
101 0.29
102 0.31
103 0.31
104 0.27
105 0.36
106 0.34
107 0.28
108 0.28
109 0.27