Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5M7F8

Protein Details
Accession C5M7F8    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-31NHFCAFKVKTDKNQNFCRNEHydrophilic
264-293EGSKDTKESGDKKRRKKRPRVEIEYEDELHBasic
NLS Segment(s)
PositionSequence
139-152SKVKRREENRERKA
273-283GDKKRRKKRPR
Subcellular Location(s) nucl 23, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR006958  Mak16  
Gene Ontology GO:0005730  C:nucleolus  
KEGG ctp:CTRG_01790  -  
Pfam View protein in Pfam  
PF04874  Mak16  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSDDIVWQTINNHFCAFKVKTDKNQNFCRNEYNVTGFCNRQSCPLANSRYATVKNVGGRLYLYMKTAERTHMPNRWWERIKLSKNYTKALKQIDERLQYWQPFLIHKCKQRFTRLTQVAITERRLALGEEERHYVGVKSKVKRREENRERKALSAAKIEKQIEKELLERLKSGAYGDKPLNVDNAIWQKVMGKIDEVEDEEEFDEDEEEEEEDESEGEVEFVEDDDEEDEMVDMEELQQWLGESGSSDDDSEESEDDEDDEEEEGSKDTKESGDKKRRKKRPRVEIEYEDELHTNIATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.28
3 0.28
4 0.3
5 0.38
6 0.43
7 0.51
8 0.62
9 0.71
10 0.72
11 0.8
12 0.81
13 0.77
14 0.74
15 0.71
16 0.64
17 0.59
18 0.55
19 0.51
20 0.43
21 0.41
22 0.41
23 0.35
24 0.36
25 0.35
26 0.31
27 0.31
28 0.34
29 0.32
30 0.32
31 0.39
32 0.4
33 0.41
34 0.42
35 0.39
36 0.41
37 0.4
38 0.39
39 0.34
40 0.33
41 0.32
42 0.32
43 0.3
44 0.24
45 0.23
46 0.23
47 0.23
48 0.2
49 0.17
50 0.17
51 0.18
52 0.2
53 0.21
54 0.22
55 0.21
56 0.26
57 0.31
58 0.35
59 0.35
60 0.42
61 0.47
62 0.53
63 0.53
64 0.5
65 0.52
66 0.56
67 0.61
68 0.61
69 0.62
70 0.6
71 0.6
72 0.63
73 0.6
74 0.54
75 0.53
76 0.5
77 0.47
78 0.44
79 0.48
80 0.5
81 0.49
82 0.46
83 0.45
84 0.43
85 0.39
86 0.36
87 0.31
88 0.24
89 0.24
90 0.27
91 0.3
92 0.32
93 0.39
94 0.45
95 0.5
96 0.54
97 0.6
98 0.62
99 0.6
100 0.65
101 0.61
102 0.57
103 0.51
104 0.49
105 0.43
106 0.4
107 0.35
108 0.26
109 0.21
110 0.19
111 0.18
112 0.16
113 0.13
114 0.17
115 0.18
116 0.17
117 0.19
118 0.18
119 0.18
120 0.18
121 0.17
122 0.15
123 0.2
124 0.25
125 0.29
126 0.35
127 0.43
128 0.49
129 0.57
130 0.6
131 0.63
132 0.68
133 0.74
134 0.74
135 0.75
136 0.7
137 0.62
138 0.6
139 0.53
140 0.44
141 0.41
142 0.37
143 0.31
144 0.35
145 0.35
146 0.32
147 0.3
148 0.3
149 0.23
150 0.22
151 0.21
152 0.21
153 0.22
154 0.2
155 0.18
156 0.17
157 0.16
158 0.15
159 0.14
160 0.14
161 0.12
162 0.16
163 0.16
164 0.18
165 0.18
166 0.19
167 0.19
168 0.15
169 0.14
170 0.15
171 0.19
172 0.17
173 0.16
174 0.16
175 0.16
176 0.19
177 0.2
178 0.16
179 0.12
180 0.11
181 0.12
182 0.14
183 0.13
184 0.12
185 0.1
186 0.11
187 0.1
188 0.1
189 0.08
190 0.07
191 0.07
192 0.05
193 0.06
194 0.05
195 0.05
196 0.06
197 0.06
198 0.06
199 0.06
200 0.06
201 0.05
202 0.05
203 0.05
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.05
213 0.05
214 0.05
215 0.05
216 0.05
217 0.05
218 0.05
219 0.04
220 0.04
221 0.04
222 0.06
223 0.06
224 0.06
225 0.06
226 0.06
227 0.07
228 0.07
229 0.06
230 0.05
231 0.07
232 0.09
233 0.09
234 0.09
235 0.09
236 0.09
237 0.11
238 0.12
239 0.1
240 0.09
241 0.09
242 0.09
243 0.09
244 0.1
245 0.09
246 0.08
247 0.08
248 0.08
249 0.08
250 0.09
251 0.09
252 0.09
253 0.09
254 0.09
255 0.09
256 0.12
257 0.19
258 0.27
259 0.37
260 0.48
261 0.57
262 0.68
263 0.78
264 0.86
265 0.89
266 0.92
267 0.92
268 0.93
269 0.94
270 0.93
271 0.92
272 0.89
273 0.85
274 0.81
275 0.72
276 0.62
277 0.51
278 0.41
279 0.32