Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TS82

Protein Details
Accession A0A5N6TS82    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
115-143VPERAPKPERSQNRDRRNRKPKPSAFAKEBasic
169-188EAMTRARRPDQQGKRRLGREBasic
NLS Segment(s)
PositionSequence
56-62KAKVKKA
119-184APKPERSQNRDRRNRKPKPSAFAKEMELAEKRKQEAQRRQEERDFRQKDREAMTRARRPDQQGKRR
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MAPKRSRDVDAKPEEQQRTAEPPVKKKKGFSVGPANLPDGTYRRKTQKLKADLIQKAKVKKAYAKVKAEELAAAPRKSVYERALELEEKEHNSPQIEPASLELHPDRQAMLDEPVPERAPKPERSQNRDRRNRKPKPSAFAKEMELAEKRKQEAQRRQEERDFRQKDREAMTRARRPDQQGKRRLGRESTVLLNRVQRMVGQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.57
3 0.51
4 0.45
5 0.44
6 0.46
7 0.46
8 0.43
9 0.51
10 0.6
11 0.67
12 0.66
13 0.63
14 0.66
15 0.69
16 0.66
17 0.64
18 0.64
19 0.6
20 0.62
21 0.6
22 0.52
23 0.42
24 0.39
25 0.33
26 0.26
27 0.26
28 0.25
29 0.3
30 0.35
31 0.44
32 0.5
33 0.57
34 0.63
35 0.66
36 0.68
37 0.68
38 0.7
39 0.68
40 0.68
41 0.66
42 0.6
43 0.56
44 0.54
45 0.52
46 0.46
47 0.46
48 0.49
49 0.52
50 0.57
51 0.59
52 0.56
53 0.55
54 0.53
55 0.47
56 0.38
57 0.28
58 0.27
59 0.26
60 0.24
61 0.2
62 0.19
63 0.2
64 0.2
65 0.23
66 0.17
67 0.16
68 0.17
69 0.19
70 0.21
71 0.21
72 0.2
73 0.19
74 0.18
75 0.17
76 0.17
77 0.15
78 0.14
79 0.14
80 0.14
81 0.15
82 0.14
83 0.12
84 0.11
85 0.12
86 0.13
87 0.12
88 0.13
89 0.1
90 0.11
91 0.11
92 0.11
93 0.1
94 0.09
95 0.09
96 0.09
97 0.1
98 0.1
99 0.11
100 0.11
101 0.13
102 0.13
103 0.13
104 0.12
105 0.17
106 0.2
107 0.23
108 0.29
109 0.36
110 0.45
111 0.52
112 0.63
113 0.67
114 0.74
115 0.8
116 0.81
117 0.84
118 0.86
119 0.89
120 0.88
121 0.89
122 0.85
123 0.83
124 0.85
125 0.8
126 0.73
127 0.66
128 0.58
129 0.52
130 0.45
131 0.4
132 0.33
133 0.3
134 0.31
135 0.31
136 0.31
137 0.32
138 0.39
139 0.46
140 0.53
141 0.59
142 0.65
143 0.69
144 0.74
145 0.75
146 0.76
147 0.74
148 0.74
149 0.71
150 0.64
151 0.67
152 0.64
153 0.62
154 0.59
155 0.59
156 0.54
157 0.57
158 0.63
159 0.61
160 0.63
161 0.63
162 0.63
163 0.64
164 0.69
165 0.7
166 0.71
167 0.72
168 0.77
169 0.8
170 0.79
171 0.77
172 0.72
173 0.65
174 0.6
175 0.55
176 0.54
177 0.5
178 0.47
179 0.43
180 0.44
181 0.42
182 0.38
183 0.34