Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TY94

Protein Details
Accession A0A5N6TY94    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-51TASGLPSPKPPRHPKRDKNPTSKGLDRQKRQRDARARRKTLBasic
NLS Segment(s)
PositionSequence
18-49PKPPRHPKRDKNPTSKGLDRQKRQRDARARRK
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Amino Acid Sequences MKLPTLPLLHTASGLPSPKPPRHPKRDKNPTSKGLDRQKRQRDARARRKTLLREVSCGALTLSATTGKSATSAWFVKYAGFSVWDCAAPECACCWMRGGLRLFWIGVRGEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.23
4 0.31
5 0.35
6 0.45
7 0.54
8 0.6
9 0.7
10 0.8
11 0.83
12 0.86
13 0.92
14 0.92
15 0.92
16 0.9
17 0.86
18 0.83
19 0.78
20 0.76
21 0.75
22 0.75
23 0.73
24 0.74
25 0.76
26 0.78
27 0.77
28 0.77
29 0.78
30 0.79
31 0.82
32 0.83
33 0.78
34 0.74
35 0.75
36 0.7
37 0.69
38 0.67
39 0.57
40 0.49
41 0.45
42 0.42
43 0.35
44 0.3
45 0.21
46 0.11
47 0.09
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.1
59 0.11
60 0.12
61 0.14
62 0.14
63 0.14
64 0.14
65 0.14
66 0.1
67 0.12
68 0.11
69 0.12
70 0.13
71 0.13
72 0.13
73 0.13
74 0.15
75 0.13
76 0.13
77 0.12
78 0.16
79 0.16
80 0.16
81 0.17
82 0.19
83 0.22
84 0.28
85 0.31
86 0.27
87 0.3
88 0.31
89 0.29
90 0.25
91 0.25