Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TNM0

Protein Details
Accession A0A5N6TNM0   
Localization Confidence High
Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
74-96ELLRTGKKARKTRRDRALQDLNVHydrophilic
101-121ETYVDGRGRKKERREKKVKGEBasic
NLS Segment(s)
PositionSequence
80-87KKARKTRR
107-121RGRKKERREKKVKGE
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
Amino Acid Sequences MSFTKNLTRALNARTLTTYPPHEPLEYRLSKLSISKIKQEALRPEPDLRHVVGWASVNRVAGDMMYQDLVRSVELLRTGKKARKTRRDRALQDLNVQADVETYVDGRGRKKERREKKVKGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.3
4 0.3
5 0.32
6 0.28
7 0.31
8 0.32
9 0.3
10 0.3
11 0.32
12 0.37
13 0.34
14 0.32
15 0.3
16 0.29
17 0.28
18 0.29
19 0.32
20 0.3
21 0.3
22 0.35
23 0.36
24 0.39
25 0.42
26 0.45
27 0.45
28 0.42
29 0.44
30 0.4
31 0.4
32 0.37
33 0.37
34 0.33
35 0.26
36 0.22
37 0.18
38 0.15
39 0.13
40 0.14
41 0.12
42 0.12
43 0.12
44 0.12
45 0.12
46 0.12
47 0.1
48 0.08
49 0.07
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.09
62 0.11
63 0.12
64 0.16
65 0.21
66 0.25
67 0.34
68 0.42
69 0.5
70 0.6
71 0.68
72 0.74
73 0.79
74 0.85
75 0.81
76 0.81
77 0.81
78 0.73
79 0.68
80 0.62
81 0.53
82 0.43
83 0.38
84 0.28
85 0.18
86 0.16
87 0.11
88 0.07
89 0.06
90 0.07
91 0.1
92 0.12
93 0.16
94 0.25
95 0.33
96 0.41
97 0.52
98 0.62
99 0.7
100 0.79
101 0.86