Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SEN2

Protein Details
Accession A0A5N6SEN2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-58SDDWILKQRKKRRRWICCGFLIHydrophilic
NLS Segment(s)
PositionSequence
45-49RKKRR
Subcellular Location(s) plas 18, mito 5, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MALVRDPAFWRRFSRAIHLDEEAKASKMENKSGVIYSDDWILKQRKKRRRWICCGFLIFAAFAIVVAGAVVVLWWFHSHNWLRKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.47
4 0.46
5 0.44
6 0.4
7 0.36
8 0.37
9 0.28
10 0.22
11 0.19
12 0.16
13 0.19
14 0.19
15 0.21
16 0.2
17 0.2
18 0.21
19 0.21
20 0.22
21 0.18
22 0.17
23 0.14
24 0.16
25 0.14
26 0.13
27 0.17
28 0.21
29 0.23
30 0.3
31 0.39
32 0.45
33 0.53
34 0.64
35 0.7
36 0.76
37 0.82
38 0.84
39 0.81
40 0.79
41 0.73
42 0.63
43 0.53
44 0.43
45 0.33
46 0.23
47 0.16
48 0.09
49 0.06
50 0.05
51 0.04
52 0.03
53 0.03
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.03
61 0.04
62 0.06
63 0.06
64 0.15
65 0.23