Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SMK0

Protein Details
Accession A0A5N6SMK0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
132-151YDNKGHKGHKNEKDDKHEKDBasic
162-182KDDKHEKGDKHEKGRKEHGRYBasic
NLS Segment(s)
PositionSequence
136-181GHKGHKNEKDDKHEKDDKHEKDDKHEKDDKHEKGDKHEKGRKEHGR
Subcellular Location(s) cyto 16, extr 5, mito 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001338  Hydrophobin  
Gene Ontology GO:0009277  C:fungal-type cell wall  
GO:0005199  F:structural constituent of cell wall  
Amino Acid Sequences MYATTIVNFFMLAVAASAAATAKAADSKALQKAAEGKCDIGNIACCNSVHDEKDDTLVSLLKDGLIHNLVGNEDSPCAKASLIDELGLLSLIKHTNEGPVCKNVIACCPGGTCVAIDGSAEKEKSKRGDDDYDNKGHKGHKNEKDDKHEKDDKHEKDDKHEKDDKHEKGDKHEKGRKEHGRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.06
11 0.07
12 0.08
13 0.1
14 0.15
15 0.2
16 0.22
17 0.21
18 0.21
19 0.3
20 0.31
21 0.35
22 0.31
23 0.28
24 0.26
25 0.27
26 0.26
27 0.18
28 0.19
29 0.15
30 0.15
31 0.15
32 0.14
33 0.15
34 0.2
35 0.21
36 0.2
37 0.2
38 0.21
39 0.2
40 0.23
41 0.21
42 0.17
43 0.15
44 0.15
45 0.12
46 0.11
47 0.1
48 0.08
49 0.08
50 0.08
51 0.09
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.11
69 0.1
70 0.1
71 0.09
72 0.09
73 0.09
74 0.08
75 0.07
76 0.03
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.09
83 0.11
84 0.13
85 0.14
86 0.16
87 0.17
88 0.17
89 0.17
90 0.14
91 0.15
92 0.15
93 0.13
94 0.12
95 0.11
96 0.12
97 0.11
98 0.11
99 0.08
100 0.07
101 0.06
102 0.06
103 0.06
104 0.05
105 0.08
106 0.1
107 0.1
108 0.11
109 0.12
110 0.16
111 0.2
112 0.23
113 0.25
114 0.28
115 0.35
116 0.41
117 0.47
118 0.49
119 0.52
120 0.5
121 0.47
122 0.44
123 0.42
124 0.41
125 0.44
126 0.48
127 0.5
128 0.59
129 0.68
130 0.73
131 0.78
132 0.81
133 0.76
134 0.75
135 0.74
136 0.65
137 0.66
138 0.68
139 0.63
140 0.64
141 0.66
142 0.58
143 0.6
144 0.69
145 0.64
146 0.62
147 0.65
148 0.57
149 0.6
150 0.69
151 0.64
152 0.63
153 0.66
154 0.59
155 0.62
156 0.72
157 0.7
158 0.7
159 0.72
160 0.7
161 0.72
162 0.8