Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5M5F9

Protein Details
Accession C5M5F9   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
165-188KDLNAEKKKFQPRRKFRYFRVQKEBasic
NLS Segment(s)
PositionSequence
177-178RR
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003196  TFIIF_beta  
IPR040450  TFIIF_beta_HTH  
IPR040504  TFIIF_beta_N  
IPR011039  TFIIF_interaction  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005674  C:transcription factor TFIIF complex  
GO:0003677  F:DNA binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0006355  P:regulation of DNA-templated transcription  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
GO:0006368  P:transcription elongation by RNA polymerase II  
GO:0001174  P:transcriptional start site selection at RNA polymerase II promoter  
KEGG ctp:CTRG_01089  -  
Pfam View protein in Pfam  
PF02270  TFIIF_beta  
PF17683  TFIIF_beta_N  
CDD cd07980  TFIIF_beta  
Amino Acid Sequences MSSVKANTVKASPVKSPVKKPTEPSKKEDNPETSNPENFDDEPSILSDPEDYLEENESLDMNLSRGDQKVWLVKLPRYLMDEWSNKETMNGQQLGNVKIRKDSKGKLQVKLVLSDDSSDKIPHDYDIKMLNTQVNNSYAFTEENLKKFKQELTEVSEMPEQPQLKDLNAEKKKFQPRRKFRYFRVQKEGQDGQPVKKYIPFVKTIPKKTSLMGKVCHDCTVIPSKTGPKNGESLMRRQNMTQGKERPKVTVLNEIPGVIQSNAGPSIKGSSTSVFLRSTQGKNKSEGRAIRMPKKDLLDLLFRLFEEYEYWSMKGLKERTRQPESYLKESLDSIATLIKRGPYTSKYTLKPEYRRLRDAERAVRLGIDENEQNKENDENEEEEDEEMEDVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.62
4 0.66
5 0.69
6 0.7
7 0.74
8 0.76
9 0.78
10 0.76
11 0.73
12 0.74
13 0.74
14 0.75
15 0.76
16 0.73
17 0.69
18 0.7
19 0.71
20 0.64
21 0.59
22 0.55
23 0.48
24 0.44
25 0.38
26 0.35
27 0.29
28 0.25
29 0.23
30 0.22
31 0.2
32 0.17
33 0.16
34 0.13
35 0.1
36 0.11
37 0.11
38 0.1
39 0.1
40 0.13
41 0.13
42 0.12
43 0.12
44 0.11
45 0.1
46 0.11
47 0.1
48 0.07
49 0.08
50 0.1
51 0.12
52 0.12
53 0.13
54 0.13
55 0.17
56 0.23
57 0.24
58 0.27
59 0.29
60 0.31
61 0.37
62 0.38
63 0.37
64 0.35
65 0.35
66 0.35
67 0.38
68 0.41
69 0.38
70 0.4
71 0.38
72 0.33
73 0.32
74 0.3
75 0.26
76 0.28
77 0.26
78 0.22
79 0.26
80 0.29
81 0.31
82 0.35
83 0.33
84 0.26
85 0.31
86 0.34
87 0.36
88 0.39
89 0.4
90 0.45
91 0.54
92 0.59
93 0.57
94 0.59
95 0.6
96 0.55
97 0.54
98 0.45
99 0.36
100 0.3
101 0.26
102 0.22
103 0.17
104 0.16
105 0.13
106 0.12
107 0.12
108 0.12
109 0.12
110 0.14
111 0.13
112 0.14
113 0.19
114 0.2
115 0.19
116 0.2
117 0.22
118 0.2
119 0.21
120 0.21
121 0.18
122 0.17
123 0.17
124 0.16
125 0.13
126 0.13
127 0.12
128 0.18
129 0.19
130 0.23
131 0.26
132 0.25
133 0.26
134 0.27
135 0.29
136 0.25
137 0.26
138 0.26
139 0.29
140 0.32
141 0.31
142 0.31
143 0.31
144 0.26
145 0.24
146 0.24
147 0.18
148 0.14
149 0.18
150 0.17
151 0.15
152 0.19
153 0.21
154 0.28
155 0.33
156 0.35
157 0.33
158 0.41
159 0.52
160 0.57
161 0.63
162 0.64
163 0.69
164 0.77
165 0.86
166 0.84
167 0.8
168 0.82
169 0.83
170 0.8
171 0.77
172 0.73
173 0.64
174 0.64
175 0.62
176 0.51
177 0.5
178 0.43
179 0.36
180 0.35
181 0.33
182 0.27
183 0.25
184 0.27
185 0.23
186 0.25
187 0.25
188 0.23
189 0.32
190 0.39
191 0.42
192 0.43
193 0.42
194 0.4
195 0.39
196 0.45
197 0.41
198 0.38
199 0.36
200 0.37
201 0.37
202 0.37
203 0.36
204 0.28
205 0.22
206 0.2
207 0.26
208 0.22
209 0.19
210 0.2
211 0.26
212 0.29
213 0.34
214 0.33
215 0.26
216 0.28
217 0.29
218 0.35
219 0.3
220 0.33
221 0.37
222 0.38
223 0.37
224 0.34
225 0.41
226 0.4
227 0.42
228 0.43
229 0.44
230 0.5
231 0.55
232 0.56
233 0.51
234 0.46
235 0.47
236 0.42
237 0.43
238 0.35
239 0.31
240 0.31
241 0.29
242 0.26
243 0.21
244 0.21
245 0.1
246 0.1
247 0.07
248 0.08
249 0.1
250 0.1
251 0.09
252 0.08
253 0.11
254 0.1
255 0.12
256 0.11
257 0.11
258 0.14
259 0.15
260 0.17
261 0.15
262 0.16
263 0.19
264 0.24
265 0.28
266 0.34
267 0.41
268 0.41
269 0.45
270 0.51
271 0.51
272 0.53
273 0.51
274 0.5
275 0.5
276 0.54
277 0.58
278 0.58
279 0.57
280 0.54
281 0.54
282 0.48
283 0.43
284 0.39
285 0.36
286 0.31
287 0.3
288 0.26
289 0.23
290 0.23
291 0.2
292 0.17
293 0.13
294 0.14
295 0.15
296 0.17
297 0.17
298 0.17
299 0.19
300 0.21
301 0.27
302 0.3
303 0.36
304 0.42
305 0.51
306 0.58
307 0.64
308 0.64
309 0.62
310 0.64
311 0.62
312 0.6
313 0.55
314 0.46
315 0.4
316 0.39
317 0.35
318 0.26
319 0.2
320 0.14
321 0.15
322 0.15
323 0.14
324 0.15
325 0.17
326 0.17
327 0.19
328 0.24
329 0.23
330 0.31
331 0.39
332 0.46
333 0.47
334 0.53
335 0.61
336 0.65
337 0.69
338 0.72
339 0.74
340 0.74
341 0.76
342 0.74
343 0.73
344 0.72
345 0.73
346 0.72
347 0.68
348 0.62
349 0.56
350 0.52
351 0.44
352 0.39
353 0.31
354 0.27
355 0.25
356 0.26
357 0.29
358 0.3
359 0.3
360 0.28
361 0.29
362 0.26
363 0.25
364 0.26
365 0.24
366 0.26
367 0.27
368 0.26
369 0.23
370 0.22
371 0.18