Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SZN2

Protein Details
Accession A0A5N6SZN2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
250-282ITAPERKTRSPESPNKKRWRRLQGFAKHFRRSSHydrophilic
NLS Segment(s)
PositionSequence
256-276KTRSPESPNKKRWRRLQGFAK
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016137  RGS  
IPR036305  RGS_sf  
IPR044926  RGS_subdomain_2  
Pfam View protein in Pfam  
PF00615  RGS  
PROSITE View protein in PROSITE  
PS50132  RGS  
CDD cd07440  RGS  
Amino Acid Sequences MKPQSKTLYHLRPKLDEILNDTAPVPYTLGTFIAFLAQNHCLEVLEFILEAKRYRKTYDWLQDHGKKCGEDEAHEERLRRVWDRIIETYIESGAPREINVPNETREELLSYTKTYGSVPPPSLLDSAVQHMHELLRDSILIPYLRSCSGTSHVQPLSVPCLSGTERLSPSPRASDDTARRRSKFNGLIPSSPADMCSSDGSEPPTRCISRETSSQEPPGSSCSDTGRLVTGGQNWHVLPNGEGAEMSHAITAPERKTRSPESPNKKRWRRLQGFAKHFRRSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.59
3 0.5
4 0.47
5 0.47
6 0.42
7 0.38
8 0.35
9 0.27
10 0.24
11 0.22
12 0.16
13 0.09
14 0.1
15 0.1
16 0.1
17 0.1
18 0.09
19 0.09
20 0.11
21 0.12
22 0.11
23 0.14
24 0.16
25 0.16
26 0.16
27 0.16
28 0.13
29 0.12
30 0.12
31 0.09
32 0.07
33 0.07
34 0.07
35 0.09
36 0.1
37 0.12
38 0.14
39 0.2
40 0.22
41 0.26
42 0.3
43 0.34
44 0.43
45 0.51
46 0.54
47 0.53
48 0.6
49 0.65
50 0.64
51 0.63
52 0.56
53 0.45
54 0.4
55 0.41
56 0.33
57 0.27
58 0.31
59 0.32
60 0.36
61 0.38
62 0.38
63 0.32
64 0.35
65 0.36
66 0.31
67 0.27
68 0.25
69 0.29
70 0.33
71 0.34
72 0.32
73 0.3
74 0.28
75 0.26
76 0.21
77 0.16
78 0.11
79 0.09
80 0.09
81 0.08
82 0.07
83 0.1
84 0.11
85 0.14
86 0.16
87 0.18
88 0.18
89 0.2
90 0.2
91 0.18
92 0.17
93 0.15
94 0.14
95 0.14
96 0.13
97 0.12
98 0.13
99 0.12
100 0.12
101 0.12
102 0.14
103 0.16
104 0.19
105 0.19
106 0.18
107 0.19
108 0.2
109 0.19
110 0.16
111 0.13
112 0.1
113 0.11
114 0.12
115 0.11
116 0.1
117 0.1
118 0.09
119 0.09
120 0.1
121 0.08
122 0.07
123 0.07
124 0.07
125 0.07
126 0.09
127 0.08
128 0.07
129 0.07
130 0.09
131 0.09
132 0.1
133 0.1
134 0.1
135 0.13
136 0.17
137 0.17
138 0.21
139 0.21
140 0.2
141 0.19
142 0.19
143 0.19
144 0.16
145 0.15
146 0.09
147 0.11
148 0.12
149 0.14
150 0.15
151 0.15
152 0.16
153 0.18
154 0.21
155 0.21
156 0.21
157 0.22
158 0.21
159 0.21
160 0.22
161 0.28
162 0.35
163 0.42
164 0.51
165 0.54
166 0.54
167 0.53
168 0.54
169 0.55
170 0.54
171 0.51
172 0.51
173 0.48
174 0.49
175 0.48
176 0.46
177 0.39
178 0.31
179 0.25
180 0.16
181 0.13
182 0.14
183 0.13
184 0.12
185 0.11
186 0.13
187 0.17
188 0.21
189 0.21
190 0.23
191 0.28
192 0.27
193 0.27
194 0.29
195 0.3
196 0.28
197 0.35
198 0.38
199 0.38
200 0.42
201 0.45
202 0.43
203 0.38
204 0.35
205 0.31
206 0.27
207 0.22
208 0.19
209 0.19
210 0.21
211 0.21
212 0.21
213 0.19
214 0.17
215 0.17
216 0.18
217 0.19
218 0.18
219 0.19
220 0.21
221 0.19
222 0.2
223 0.2
224 0.18
225 0.15
226 0.16
227 0.15
228 0.13
229 0.12
230 0.11
231 0.14
232 0.14
233 0.13
234 0.1
235 0.09
236 0.1
237 0.13
238 0.18
239 0.18
240 0.25
241 0.28
242 0.3
243 0.37
244 0.44
245 0.5
246 0.56
247 0.63
248 0.66
249 0.74
250 0.82
251 0.87
252 0.9
253 0.91
254 0.91
255 0.91
256 0.89
257 0.88
258 0.88
259 0.88
260 0.88
261 0.89
262 0.88
263 0.85