Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5M949

Protein Details
Accession C5M949    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
39-59FGIVHKKSSKRSENVKIENFNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002877  RNA_MeTrfase_FtsJ_dom  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
KEGG ctp:CTRG_02921  -  
Pfam View protein in Pfam  
PF01728  FtsJ  
Amino Acid Sequences MSITLCKPTIHYLRYSQSLRCLSTSGRLSEAFETIDINFGIVHKKSSKRSENVKIENFNNTSRIKHLDRRFNILNGSHRRILDLGYVPGNWITYIRNRMAKIHNIDPDKVNKKCHILGFDFMFGAPPAGVSAIQGNIFSKSAQSLIIDYFKEAAWMELKHKSILQEDELNPRSYFSKEQDEEVFINEIREIELGLNHYSTSPEKINELTKKRDLLLPDYRIDLVFQDLGKPGYQNFGFYSNSVSMPYIKYSHYESLNFAFENPNKANFDFLDASLILNCKLLKPGGKFVVRMNEVDPNDKEFELVREKLLKIFNSVLEVNNYATDNDKSLVQSFEKYFICDSKKDDHEYDPYELFAWQAPPEPVPVPIPEAETTNENNEQQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.49
4 0.5
5 0.52
6 0.49
7 0.44
8 0.4
9 0.34
10 0.39
11 0.41
12 0.34
13 0.32
14 0.31
15 0.32
16 0.31
17 0.31
18 0.23
19 0.18
20 0.17
21 0.14
22 0.16
23 0.13
24 0.11
25 0.1
26 0.1
27 0.15
28 0.14
29 0.18
30 0.23
31 0.3
32 0.38
33 0.48
34 0.56
35 0.59
36 0.69
37 0.75
38 0.79
39 0.81
40 0.81
41 0.77
42 0.7
43 0.7
44 0.63
45 0.54
46 0.49
47 0.42
48 0.36
49 0.33
50 0.37
51 0.35
52 0.42
53 0.48
54 0.53
55 0.55
56 0.62
57 0.62
58 0.57
59 0.56
60 0.51
61 0.52
62 0.49
63 0.52
64 0.48
65 0.44
66 0.43
67 0.39
68 0.36
69 0.32
70 0.26
71 0.22
72 0.2
73 0.2
74 0.19
75 0.18
76 0.17
77 0.12
78 0.1
79 0.1
80 0.14
81 0.2
82 0.23
83 0.28
84 0.29
85 0.35
86 0.39
87 0.45
88 0.45
89 0.46
90 0.49
91 0.47
92 0.48
93 0.46
94 0.5
95 0.5
96 0.47
97 0.46
98 0.42
99 0.44
100 0.46
101 0.46
102 0.42
103 0.37
104 0.37
105 0.35
106 0.32
107 0.27
108 0.23
109 0.2
110 0.14
111 0.12
112 0.08
113 0.05
114 0.04
115 0.05
116 0.05
117 0.04
118 0.05
119 0.06
120 0.06
121 0.07
122 0.07
123 0.08
124 0.08
125 0.08
126 0.07
127 0.07
128 0.08
129 0.08
130 0.08
131 0.08
132 0.09
133 0.12
134 0.11
135 0.11
136 0.11
137 0.11
138 0.11
139 0.1
140 0.09
141 0.09
142 0.1
143 0.12
144 0.16
145 0.17
146 0.17
147 0.18
148 0.19
149 0.2
150 0.21
151 0.2
152 0.22
153 0.22
154 0.3
155 0.31
156 0.31
157 0.28
158 0.27
159 0.26
160 0.21
161 0.23
162 0.18
163 0.25
164 0.23
165 0.26
166 0.26
167 0.27
168 0.25
169 0.24
170 0.22
171 0.13
172 0.13
173 0.1
174 0.09
175 0.07
176 0.07
177 0.06
178 0.04
179 0.05
180 0.06
181 0.07
182 0.07
183 0.06
184 0.07
185 0.08
186 0.08
187 0.1
188 0.1
189 0.1
190 0.11
191 0.13
192 0.19
193 0.26
194 0.3
195 0.32
196 0.34
197 0.35
198 0.35
199 0.36
200 0.31
201 0.31
202 0.34
203 0.32
204 0.3
205 0.3
206 0.29
207 0.26
208 0.25
209 0.18
210 0.12
211 0.1
212 0.09
213 0.09
214 0.09
215 0.1
216 0.1
217 0.1
218 0.09
219 0.12
220 0.12
221 0.12
222 0.12
223 0.15
224 0.15
225 0.15
226 0.18
227 0.15
228 0.15
229 0.14
230 0.14
231 0.12
232 0.13
233 0.15
234 0.13
235 0.12
236 0.14
237 0.17
238 0.21
239 0.22
240 0.22
241 0.22
242 0.23
243 0.25
244 0.23
245 0.2
246 0.21
247 0.2
248 0.25
249 0.24
250 0.25
251 0.25
252 0.25
253 0.27
254 0.21
255 0.25
256 0.2
257 0.19
258 0.18
259 0.16
260 0.16
261 0.15
262 0.15
263 0.11
264 0.11
265 0.11
266 0.09
267 0.1
268 0.12
269 0.17
270 0.2
271 0.26
272 0.32
273 0.35
274 0.36
275 0.37
276 0.44
277 0.4
278 0.38
279 0.33
280 0.33
281 0.32
282 0.36
283 0.34
284 0.28
285 0.29
286 0.28
287 0.26
288 0.2
289 0.23
290 0.24
291 0.24
292 0.23
293 0.25
294 0.26
295 0.3
296 0.34
297 0.3
298 0.28
299 0.3
300 0.27
301 0.27
302 0.28
303 0.24
304 0.22
305 0.23
306 0.19
307 0.19
308 0.18
309 0.14
310 0.16
311 0.16
312 0.15
313 0.15
314 0.16
315 0.15
316 0.17
317 0.2
318 0.19
319 0.23
320 0.22
321 0.28
322 0.27
323 0.27
324 0.27
325 0.31
326 0.33
327 0.31
328 0.34
329 0.37
330 0.42
331 0.46
332 0.47
333 0.46
334 0.49
335 0.51
336 0.51
337 0.42
338 0.37
339 0.32
340 0.29
341 0.25
342 0.19
343 0.17
344 0.13
345 0.17
346 0.18
347 0.18
348 0.21
349 0.21
350 0.21
351 0.21
352 0.21
353 0.21
354 0.21
355 0.24
356 0.21
357 0.23
358 0.23
359 0.24
360 0.25
361 0.27
362 0.31