Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6T7U0

Protein Details
Accession A0A5N6T7U0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
111-141LEQADRRKLKSKHRRPVRKRVRQVRTCNLPVHydrophilic
NLS Segment(s)
PositionSequence
116-132RRKLKSKHRRPVRKRVR
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MSAPLNEEHGLVSRPWTQRQIERVVEPRFHDYYREPRPHWVWVGYRVHARCWELLSYHELGAIAEKDLAIVLAALRQRFKLGRQRKAGIPEMTAEDPVRTKCVSEAIGLALEQADRRKLKSKHRRPVRKRVRQVRTCNLPVEILYMIAEYLPSQAIANMERAWGFRFGNTFWYSRIPTKIFHEVQDVADEDLDWQRLCLKLERRLEKSEALNTRRYLLKCLDEILSIVKTLMDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.36
4 0.38
5 0.43
6 0.5
7 0.54
8 0.51
9 0.53
10 0.57
11 0.56
12 0.55
13 0.52
14 0.51
15 0.47
16 0.43
17 0.4
18 0.38
19 0.42
20 0.48
21 0.53
22 0.49
23 0.54
24 0.57
25 0.58
26 0.56
27 0.52
28 0.45
29 0.46
30 0.49
31 0.44
32 0.47
33 0.43
34 0.42
35 0.41
36 0.39
37 0.32
38 0.29
39 0.28
40 0.21
41 0.22
42 0.24
43 0.21
44 0.19
45 0.18
46 0.15
47 0.13
48 0.15
49 0.13
50 0.09
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.04
57 0.03
58 0.03
59 0.06
60 0.08
61 0.09
62 0.09
63 0.1
64 0.12
65 0.14
66 0.19
67 0.27
68 0.35
69 0.43
70 0.49
71 0.53
72 0.54
73 0.59
74 0.6
75 0.51
76 0.43
77 0.35
78 0.32
79 0.28
80 0.25
81 0.2
82 0.13
83 0.13
84 0.13
85 0.14
86 0.1
87 0.1
88 0.09
89 0.12
90 0.12
91 0.11
92 0.11
93 0.1
94 0.1
95 0.09
96 0.09
97 0.06
98 0.05
99 0.05
100 0.06
101 0.09
102 0.1
103 0.12
104 0.2
105 0.26
106 0.37
107 0.48
108 0.58
109 0.64
110 0.74
111 0.84
112 0.84
113 0.9
114 0.9
115 0.9
116 0.9
117 0.9
118 0.9
119 0.88
120 0.88
121 0.85
122 0.82
123 0.74
124 0.65
125 0.55
126 0.45
127 0.36
128 0.29
129 0.2
130 0.12
131 0.09
132 0.07
133 0.06
134 0.05
135 0.05
136 0.03
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.06
143 0.07
144 0.09
145 0.08
146 0.09
147 0.09
148 0.1
149 0.11
150 0.12
151 0.12
152 0.11
153 0.13
154 0.13
155 0.19
156 0.21
157 0.2
158 0.19
159 0.23
160 0.25
161 0.27
162 0.32
163 0.27
164 0.28
165 0.33
166 0.4
167 0.38
168 0.36
169 0.38
170 0.34
171 0.33
172 0.32
173 0.28
174 0.19
175 0.17
176 0.15
177 0.12
178 0.12
179 0.13
180 0.1
181 0.09
182 0.12
183 0.14
184 0.16
185 0.22
186 0.27
187 0.35
188 0.45
189 0.53
190 0.56
191 0.59
192 0.6
193 0.58
194 0.56
195 0.56
196 0.56
197 0.52
198 0.53
199 0.48
200 0.49
201 0.5
202 0.47
203 0.43
204 0.39
205 0.41
206 0.36
207 0.37
208 0.35
209 0.29
210 0.28
211 0.27
212 0.22
213 0.17
214 0.15