Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SEC0

Protein Details
Accession A0A5N6SEC0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-83DLKNEQEKEKVKKNRRREDSRVTRDIIBasic
NLS Segment(s)
PositionSequence
66-72KVKKNRR
Subcellular Location(s) mito 17, extr 4, cyto 3.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences TGDRQSSAKGPTAFFLLFIISSAVRNKYLHCSVPSSPVPSIVPIVPATCENARDHHDLKNEQEKEKVKKNRRREDSRVTRDIIIIIHLTIDWRKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.14
4 0.12
5 0.11
6 0.11
7 0.07
8 0.09
9 0.12
10 0.13
11 0.15
12 0.15
13 0.17
14 0.22
15 0.25
16 0.27
17 0.27
18 0.29
19 0.28
20 0.35
21 0.35
22 0.31
23 0.28
24 0.26
25 0.25
26 0.2
27 0.21
28 0.13
29 0.13
30 0.1
31 0.1
32 0.09
33 0.09
34 0.1
35 0.09
36 0.11
37 0.1
38 0.12
39 0.16
40 0.2
41 0.21
42 0.23
43 0.27
44 0.27
45 0.32
46 0.39
47 0.38
48 0.35
49 0.41
50 0.43
51 0.45
52 0.53
53 0.59
54 0.59
55 0.66
56 0.76
57 0.8
58 0.84
59 0.87
60 0.85
61 0.87
62 0.87
63 0.86
64 0.81
65 0.73
66 0.64
67 0.55
68 0.48
69 0.37
70 0.27
71 0.19
72 0.14
73 0.11
74 0.1
75 0.11
76 0.15