Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SDS5

Protein Details
Accession A0A5N6SDS5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-91ICDIRTRKSTCKRKVRDQWVSIKCRNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
Amino Acid Sequences MKTSLISIVVLAAVITAAVESGGHYNTSDLPEIVVTPPSNANRPSGNTIGPNNDNLLGQNRILYGICDIRTRKSTCKRKVRDQWVSIKCRNKCTEGSCRFDSSQRDEPAECSIPKQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.02
5 0.02
6 0.02
7 0.03
8 0.05
9 0.06
10 0.06
11 0.07
12 0.08
13 0.09
14 0.11
15 0.12
16 0.1
17 0.1
18 0.1
19 0.11
20 0.1
21 0.11
22 0.1
23 0.1
24 0.14
25 0.15
26 0.19
27 0.19
28 0.2
29 0.2
30 0.22
31 0.26
32 0.23
33 0.23
34 0.22
35 0.23
36 0.25
37 0.23
38 0.21
39 0.18
40 0.16
41 0.15
42 0.13
43 0.14
44 0.11
45 0.1
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.08
52 0.09
53 0.1
54 0.13
55 0.14
56 0.16
57 0.22
58 0.25
59 0.32
60 0.41
61 0.51
62 0.57
63 0.67
64 0.72
65 0.77
66 0.85
67 0.86
68 0.86
69 0.82
70 0.83
71 0.81
72 0.81
73 0.77
74 0.76
75 0.69
76 0.68
77 0.64
78 0.58
79 0.55
80 0.54
81 0.58
82 0.57
83 0.6
84 0.55
85 0.56
86 0.54
87 0.53
88 0.52
89 0.49
90 0.51
91 0.48
92 0.48
93 0.43
94 0.43
95 0.45
96 0.44
97 0.37