Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6T499

Protein Details
Accession A0A5N6T499   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-25LYQTQKSTKTREQRGRRDQIDNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MMTLYQTQKSTKTREQRGRRDQIDNSCRFKFWKVFVLPYFFFCFRNLALPKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.76
3 0.8
4 0.85
5 0.86
6 0.82
7 0.78
8 0.72
9 0.72
10 0.71
11 0.66
12 0.61
13 0.52
14 0.48
15 0.43
16 0.41
17 0.36
18 0.29
19 0.32
20 0.29
21 0.35
22 0.37
23 0.41
24 0.38
25 0.37
26 0.4
27 0.32
28 0.31
29 0.26
30 0.26
31 0.21
32 0.29