Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6SZG4

Protein Details
Accession A0A5N6SZG4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-29YSMYMSLWAPKRKRKRKEKKDMLLEGVEHydrophilic
NLS Segment(s)
PositionSequence
11-21PKRKRKRKEKK
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.833
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYSMYMSLWAPKRKRKRKEKKDMLLEGVEPSTSASRHAESEKTELPHKSHAITTRPKEPHLTQWRILYGLCFHCFTYFPLVWCVGLRGGFEYFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.87
4 0.89
5 0.94
6 0.95
7 0.94
8 0.94
9 0.9
10 0.83
11 0.74
12 0.63
13 0.53
14 0.41
15 0.31
16 0.2
17 0.15
18 0.11
19 0.09
20 0.1
21 0.1
22 0.1
23 0.12
24 0.14
25 0.15
26 0.16
27 0.2
28 0.22
29 0.22
30 0.24
31 0.24
32 0.24
33 0.26
34 0.25
35 0.22
36 0.21
37 0.24
38 0.27
39 0.33
40 0.34
41 0.39
42 0.4
43 0.4
44 0.43
45 0.41
46 0.45
47 0.48
48 0.5
49 0.43
50 0.45
51 0.45
52 0.4
53 0.38
54 0.29
55 0.24
56 0.23
57 0.22
58 0.2
59 0.19
60 0.19
61 0.2
62 0.21
63 0.24
64 0.21
65 0.21
66 0.23
67 0.23
68 0.23
69 0.22
70 0.22
71 0.16
72 0.16
73 0.15
74 0.15