Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6SW18

Protein Details
Accession A0A5N6SW18    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
37-56RPKARLRCSWHSKQLRFETHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, plas 6, cyto_mito 6, extr 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPILSLLFHNVIHNGPLALFMLYFGLWTSLCLSLTNRPKARLRCSWHSKQLRFETH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.08
5 0.07
6 0.06
7 0.05
8 0.05
9 0.05
10 0.05
11 0.04
12 0.04
13 0.04
14 0.05
15 0.06
16 0.06
17 0.07
18 0.08
19 0.09
20 0.16
21 0.24
22 0.32
23 0.33
24 0.37
25 0.44
26 0.51
27 0.57
28 0.58
29 0.59
30 0.61
31 0.68
32 0.73
33 0.76
34 0.8
35 0.78
36 0.79