Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6SUU6

Protein Details
Accession A0A5N6SUU6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-89TAKESMTHKTRRGRNKSNKRRBasic
NLS Segment(s)
PositionSequence
77-89KTRRGRNKSNKRR
Subcellular Location(s) mito 6plas 6, E.R. 4, nucl 3.5, golg 3, cyto_nucl 2.5, extr 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLFGITNWLYCLYKYVQKHTNEKLDNVHTEFYYCKHILWVIIICIFPLDRAGVYPIFIFIIARNRTYTAKESMTHKTRRGRNKSNKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.32
4 0.37
5 0.42
6 0.5
7 0.53
8 0.6
9 0.55
10 0.54
11 0.52
12 0.49
13 0.47
14 0.42
15 0.36
16 0.26
17 0.25
18 0.23
19 0.19
20 0.21
21 0.17
22 0.15
23 0.14
24 0.15
25 0.14
26 0.15
27 0.14
28 0.09
29 0.1
30 0.09
31 0.08
32 0.08
33 0.08
34 0.06
35 0.05
36 0.05
37 0.04
38 0.04
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.15
49 0.16
50 0.17
51 0.18
52 0.2
53 0.22
54 0.26
55 0.28
56 0.25
57 0.27
58 0.29
59 0.32
60 0.4
61 0.46
62 0.49
63 0.53
64 0.57
65 0.62
66 0.7
67 0.76
68 0.77
69 0.81