Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SGA5

Protein Details
Accession A0A5N6SGA5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
298-318IRLAKESKKDRAKRGGQAAKNHydrophilic
NLS Segment(s)
PositionSequence
304-312SKKDRAKRG
337-385RLTRRAKGSGGALDRSRKRKHGEEGPRGDGAAVGQIFEKRRKKIEGWKR
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MATATQQPENSGLQNISALLETITGCLTTAGSSLPKEKRDAPSEVSIEPPQDGISLLDTKSDLLLSYTHNLVFLMLFQLRGLSKDRDGETEADQSLREETVKKLAELRVYLDRGVRPLEGRLKYQIDKVIKAAENVERTERTAAKTKATEAEYSGSEDESASEKGSSDGESDSAEGSDEDQEDIDEMAYRPNVSAFAKKVEPEARAERSTTKAPSDGIYRPPKIMPTALPTTETRERRERGPRRSTVIDEFVNAEMSSAPMAEPSIGSTIVHGGRHTKSKKEREHEVERTTYEETNFIRLAKESKKDRAKRGGQAAKNTYGGEEWRGLTEGADRISRLTRRAKGSGGALDRSRKRKHGEEGPRGDGAAVGQIFEKRRKKIEGWKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.15
4 0.13
5 0.11
6 0.08
7 0.09
8 0.08
9 0.08
10 0.08
11 0.07
12 0.07
13 0.07
14 0.07
15 0.06
16 0.07
17 0.08
18 0.1
19 0.12
20 0.2
21 0.26
22 0.28
23 0.32
24 0.39
25 0.45
26 0.49
27 0.52
28 0.49
29 0.51
30 0.51
31 0.48
32 0.46
33 0.39
34 0.35
35 0.3
36 0.25
37 0.17
38 0.14
39 0.14
40 0.1
41 0.11
42 0.13
43 0.12
44 0.13
45 0.13
46 0.13
47 0.13
48 0.12
49 0.09
50 0.08
51 0.09
52 0.11
53 0.13
54 0.15
55 0.14
56 0.14
57 0.14
58 0.13
59 0.12
60 0.09
61 0.1
62 0.09
63 0.09
64 0.09
65 0.11
66 0.11
67 0.13
68 0.17
69 0.16
70 0.18
71 0.24
72 0.25
73 0.26
74 0.28
75 0.28
76 0.27
77 0.28
78 0.26
79 0.21
80 0.2
81 0.18
82 0.16
83 0.15
84 0.13
85 0.11
86 0.12
87 0.19
88 0.2
89 0.2
90 0.24
91 0.26
92 0.28
93 0.27
94 0.29
95 0.28
96 0.28
97 0.28
98 0.27
99 0.25
100 0.23
101 0.24
102 0.21
103 0.16
104 0.2
105 0.27
106 0.26
107 0.27
108 0.3
109 0.33
110 0.34
111 0.36
112 0.38
113 0.33
114 0.32
115 0.31
116 0.33
117 0.29
118 0.28
119 0.28
120 0.26
121 0.25
122 0.25
123 0.27
124 0.21
125 0.21
126 0.24
127 0.23
128 0.21
129 0.28
130 0.28
131 0.29
132 0.29
133 0.3
134 0.31
135 0.31
136 0.29
137 0.22
138 0.23
139 0.19
140 0.2
141 0.18
142 0.13
143 0.11
144 0.1
145 0.1
146 0.1
147 0.09
148 0.08
149 0.08
150 0.08
151 0.08
152 0.09
153 0.08
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.06
161 0.06
162 0.05
163 0.05
164 0.06
165 0.06
166 0.06
167 0.05
168 0.05
169 0.05
170 0.06
171 0.05
172 0.05
173 0.05
174 0.05
175 0.06
176 0.06
177 0.05
178 0.06
179 0.07
180 0.08
181 0.11
182 0.11
183 0.14
184 0.14
185 0.15
186 0.18
187 0.2
188 0.2
189 0.22
190 0.26
191 0.27
192 0.27
193 0.28
194 0.26
195 0.26
196 0.28
197 0.25
198 0.21
199 0.18
200 0.18
201 0.18
202 0.21
203 0.2
204 0.25
205 0.3
206 0.3
207 0.3
208 0.3
209 0.3
210 0.28
211 0.27
212 0.2
213 0.19
214 0.22
215 0.21
216 0.23
217 0.22
218 0.27
219 0.33
220 0.34
221 0.33
222 0.37
223 0.38
224 0.43
225 0.54
226 0.56
227 0.59
228 0.65
229 0.65
230 0.63
231 0.65
232 0.62
233 0.55
234 0.51
235 0.41
236 0.33
237 0.3
238 0.24
239 0.22
240 0.18
241 0.13
242 0.08
243 0.08
244 0.07
245 0.06
246 0.05
247 0.04
248 0.04
249 0.04
250 0.04
251 0.05
252 0.06
253 0.06
254 0.06
255 0.07
256 0.1
257 0.12
258 0.12
259 0.12
260 0.15
261 0.17
262 0.27
263 0.29
264 0.35
265 0.43
266 0.52
267 0.61
268 0.64
269 0.71
270 0.71
271 0.78
272 0.77
273 0.72
274 0.66
275 0.57
276 0.54
277 0.47
278 0.4
279 0.3
280 0.27
281 0.22
282 0.23
283 0.23
284 0.2
285 0.19
286 0.18
287 0.24
288 0.25
289 0.33
290 0.35
291 0.44
292 0.54
293 0.61
294 0.69
295 0.74
296 0.75
297 0.76
298 0.8
299 0.8
300 0.75
301 0.77
302 0.73
303 0.66
304 0.6
305 0.52
306 0.41
307 0.33
308 0.29
309 0.23
310 0.2
311 0.17
312 0.16
313 0.17
314 0.16
315 0.15
316 0.17
317 0.17
318 0.16
319 0.17
320 0.16
321 0.17
322 0.24
323 0.26
324 0.28
325 0.35
326 0.4
327 0.45
328 0.49
329 0.49
330 0.46
331 0.49
332 0.5
333 0.46
334 0.44
335 0.42
336 0.47
337 0.53
338 0.58
339 0.59
340 0.59
341 0.61
342 0.65
343 0.7
344 0.71
345 0.75
346 0.77
347 0.78
348 0.76
349 0.7
350 0.61
351 0.51
352 0.41
353 0.3
354 0.25
355 0.17
356 0.13
357 0.14
358 0.18
359 0.23
360 0.32
361 0.39
362 0.39
363 0.46
364 0.52
365 0.59