Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5MHF7

Protein Details
Accession C5MHF7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
161-181AFEKRLKKLRIEENMHKKHMKBasic
NLS Segment(s)
PositionSequence
177-181KKHMK
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044996  COQ10-like  
IPR005031  COQ10_START  
IPR023393  START-like_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0048039  F:ubiquinone binding  
GO:0045333  P:cellular respiration  
GO:0006744  P:ubiquinone biosynthetic process  
KEGG ctp:CTRG_05511  -  
Pfam View protein in Pfam  
PF03364  Polyketide_cyc  
CDD cd07813  COQ10p_like  
Amino Acid Sequences MITRVRPCYNTTRTTIRTFFGSSKPQSYELSKILHGSPEQVYNIVSQVDKYKQFVPFVEESFISDKEQETNIPTKAGLVVGWKDIVERFECDLKCIKNCKVNAKSIQLDLFENLETEWNFKEFSKDKCQVDFKLLYKFKNPLYDKVSFMFAPQVTEIMIGAFEKRLKKLRIEENMHKKHMKSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.55
3 0.47
4 0.44
5 0.42
6 0.4
7 0.38
8 0.41
9 0.38
10 0.41
11 0.42
12 0.42
13 0.41
14 0.41
15 0.4
16 0.36
17 0.35
18 0.3
19 0.3
20 0.28
21 0.27
22 0.24
23 0.22
24 0.2
25 0.2
26 0.2
27 0.18
28 0.17
29 0.15
30 0.16
31 0.13
32 0.12
33 0.09
34 0.13
35 0.17
36 0.18
37 0.2
38 0.24
39 0.25
40 0.27
41 0.27
42 0.28
43 0.26
44 0.26
45 0.25
46 0.21
47 0.2
48 0.21
49 0.21
50 0.16
51 0.14
52 0.13
53 0.13
54 0.14
55 0.12
56 0.13
57 0.16
58 0.15
59 0.15
60 0.15
61 0.13
62 0.13
63 0.12
64 0.09
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.09
73 0.08
74 0.09
75 0.1
76 0.15
77 0.15
78 0.16
79 0.19
80 0.2
81 0.23
82 0.26
83 0.28
84 0.29
85 0.32
86 0.4
87 0.41
88 0.46
89 0.46
90 0.47
91 0.46
92 0.41
93 0.4
94 0.31
95 0.27
96 0.21
97 0.18
98 0.12
99 0.1
100 0.09
101 0.09
102 0.08
103 0.09
104 0.09
105 0.09
106 0.1
107 0.1
108 0.16
109 0.18
110 0.23
111 0.31
112 0.37
113 0.39
114 0.44
115 0.49
116 0.44
117 0.46
118 0.46
119 0.39
120 0.43
121 0.44
122 0.4
123 0.4
124 0.42
125 0.39
126 0.44
127 0.44
128 0.41
129 0.44
130 0.45
131 0.43
132 0.41
133 0.41
134 0.31
135 0.28
136 0.27
137 0.21
138 0.2
139 0.18
140 0.17
141 0.14
142 0.14
143 0.13
144 0.07
145 0.08
146 0.06
147 0.06
148 0.08
149 0.12
150 0.15
151 0.21
152 0.29
153 0.32
154 0.39
155 0.47
156 0.55
157 0.61
158 0.67
159 0.73
160 0.76
161 0.81
162 0.81
163 0.76
164 0.68