Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SGD0

Protein Details
Accession A0A5N6SGD0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
91-114AWPCRESKNACKIRKFRNHLNGNTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 27
Family & Domain DBs
Amino Acid Sequences MKVTTFTVLVFTILSVSHAAVPPAGGGAKPVLPPLADAVTEELQVYDGECLMADQKTSTYGICVAQGKSLPASPAKPKNNKIDLRWGCDAAWPCRESKNACKIRKFRNHLNGNTIWNARCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.09
5 0.1
6 0.1
7 0.09
8 0.09
9 0.08
10 0.08
11 0.08
12 0.05
13 0.06
14 0.07
15 0.09
16 0.09
17 0.1
18 0.09
19 0.09
20 0.1
21 0.11
22 0.11
23 0.09
24 0.09
25 0.12
26 0.12
27 0.12
28 0.11
29 0.09
30 0.09
31 0.09
32 0.08
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.04
41 0.04
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.09
50 0.11
51 0.1
52 0.11
53 0.11
54 0.11
55 0.11
56 0.11
57 0.1
58 0.1
59 0.13
60 0.19
61 0.28
62 0.36
63 0.43
64 0.48
65 0.56
66 0.64
67 0.66
68 0.62
69 0.64
70 0.6
71 0.59
72 0.55
73 0.47
74 0.38
75 0.38
76 0.39
77 0.32
78 0.33
79 0.28
80 0.26
81 0.29
82 0.33
83 0.34
84 0.39
85 0.46
86 0.5
87 0.57
88 0.65
89 0.7
90 0.77
91 0.82
92 0.81
93 0.81
94 0.82
95 0.84
96 0.79
97 0.79
98 0.72
99 0.66
100 0.64
101 0.57