Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6T7P1

Protein Details
Accession A0A5N6T7P1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-61GPSARRIPRKRIRRGCPGQEDBasic
NLS Segment(s)
PositionSequence
45-54RRIPRKRIRR
Subcellular Location(s) plas 10, mito 4, cyto 3, extr 3, E.R. 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MQLPAPCDDPMHQSPYNLFALRVYLASARWRRLYRSYRTCGPSARRIPRKRIRRGCPGQEDGKVPGESFGYQWLTALCWLFRICMVNLICAIGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.34
4 0.26
5 0.23
6 0.17
7 0.18
8 0.17
9 0.16
10 0.13
11 0.1
12 0.1
13 0.19
14 0.22
15 0.23
16 0.29
17 0.3
18 0.33
19 0.42
20 0.48
21 0.5
22 0.55
23 0.57
24 0.59
25 0.61
26 0.59
27 0.56
28 0.53
29 0.52
30 0.52
31 0.56
32 0.59
33 0.6
34 0.68
35 0.72
36 0.77
37 0.78
38 0.8
39 0.77
40 0.78
41 0.82
42 0.8
43 0.78
44 0.73
45 0.66
46 0.59
47 0.54
48 0.46
49 0.42
50 0.33
51 0.26
52 0.21
53 0.19
54 0.16
55 0.14
56 0.15
57 0.13
58 0.12
59 0.13
60 0.12
61 0.12
62 0.13
63 0.14
64 0.1
65 0.11
66 0.12
67 0.12
68 0.13
69 0.16
70 0.15
71 0.21
72 0.22
73 0.21
74 0.21