Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SC01

Protein Details
Accession A0A5N6SC01   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLFRSNVPKKWKRHKIRPAKDGCNGDHydrophilic
NLS Segment(s)
PositionSequence
9-18KKWKRHKIRP
Subcellular Location(s) nucl 15, mito_nucl 12.166, cyto_nucl 11.166, mito 7
Family & Domain DBs
Amino Acid Sequences MLFRSNVPKKWKRHKIRPAKDGCNGDPSMLTEPSQSRGLPMVIHPADRCQANGLSANEERHVSPNSFRAHNGGNFEIVDPLSQKLKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.93
4 0.93
5 0.91
6 0.88
7 0.84
8 0.8
9 0.71
10 0.65
11 0.55
12 0.45
13 0.36
14 0.3
15 0.26
16 0.2
17 0.19
18 0.14
19 0.15
20 0.17
21 0.18
22 0.16
23 0.13
24 0.14
25 0.14
26 0.12
27 0.12
28 0.16
29 0.15
30 0.16
31 0.15
32 0.15
33 0.16
34 0.16
35 0.16
36 0.1
37 0.11
38 0.11
39 0.16
40 0.15
41 0.18
42 0.19
43 0.2
44 0.19
45 0.2
46 0.19
47 0.18
48 0.19
49 0.17
50 0.17
51 0.23
52 0.26
53 0.27
54 0.26
55 0.27
56 0.29
57 0.31
58 0.33
59 0.28
60 0.26
61 0.25
62 0.25
63 0.22
64 0.18
65 0.16
66 0.12
67 0.13