Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6S9J4

Protein Details
Accession A0A5N6S9J4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
34-55LQEHVRKRKQIRDGKKRAYDSGBasic
NLS Segment(s)
PositionSequence
39-57RKRKQIRDGKKRAYDSGRR
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021842  DUF3435  
Pfam View protein in Pfam  
PF11917  DUF3435  
Amino Acid Sequences MRFAASISWSIDPWRPYRLDNTSCVNQVPRVRALQEHVRKRKQIRDGKKRAYDSGRRIPVKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.25
4 0.31
5 0.37
6 0.36
7 0.37
8 0.4
9 0.38
10 0.38
11 0.37
12 0.31
13 0.28
14 0.28
15 0.27
16 0.23
17 0.21
18 0.2
19 0.2
20 0.23
21 0.29
22 0.34
23 0.42
24 0.49
25 0.53
26 0.59
27 0.64
28 0.68
29 0.69
30 0.7
31 0.71
32 0.74
33 0.79
34 0.83
35 0.86
36 0.82
37 0.79
38 0.78
39 0.77
40 0.74
41 0.74
42 0.74