Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6SLH3

Protein Details
Accession A0A5N6SLH3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
27-51ALNGAMRTHKKKRRGKKIAAENFNLHydrophilic
NLS Segment(s)
PositionSequence
33-43RTHKKKRRGKK
Subcellular Location(s) mito 12, nucl 5, plas 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MSLLPLQVLAWFLSITQHFCHMHVRRALNGAMRTHKKKRRGKKIAAENFNLQPVFYLDDVACSMDGVRRGPHSRPSLTTRFYTYGIPQTYLRCENGDILVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.18
5 0.18
6 0.19
7 0.29
8 0.29
9 0.35
10 0.39
11 0.4
12 0.37
13 0.39
14 0.4
15 0.36
16 0.36
17 0.33
18 0.35
19 0.4
20 0.45
21 0.52
22 0.57
23 0.62
24 0.68
25 0.75
26 0.78
27 0.81
28 0.84
29 0.84
30 0.87
31 0.87
32 0.83
33 0.75
34 0.67
35 0.57
36 0.5
37 0.4
38 0.28
39 0.19
40 0.14
41 0.13
42 0.09
43 0.1
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.06
50 0.06
51 0.07
52 0.08
53 0.08
54 0.1
55 0.14
56 0.17
57 0.2
58 0.28
59 0.32
60 0.34
61 0.38
62 0.43
63 0.45
64 0.45
65 0.45
66 0.42
67 0.39
68 0.37
69 0.35
70 0.32
71 0.33
72 0.32
73 0.32
74 0.3
75 0.3
76 0.35
77 0.36
78 0.34
79 0.28
80 0.27
81 0.27