Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SAF5

Protein Details
Accession A0A5N6SAF5    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MSKNVKKSSWIKKRYSESSRAKSQQRQRRKSSLFKKAAHydrophilic
NLS Segment(s)
PositionSequence
12-30KKRYSESSRAKSQQRQRRK
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MSKNVKKSSWIKKRYSESSRAKSQQRQRRKSSLFKKAAEFSLECESDVVVAIRIRKTGQAYIFDSSSQEEWLKTLPSLAYSYPLPIHQTIEDILPQLGECSPPSPVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.78
4 0.78
5 0.76
6 0.79
7 0.77
8 0.76
9 0.75
10 0.78
11 0.78
12 0.79
13 0.8
14 0.78
15 0.82
16 0.81
17 0.82
18 0.82
19 0.83
20 0.8
21 0.74
22 0.7
23 0.63
24 0.58
25 0.5
26 0.4
27 0.33
28 0.3
29 0.26
30 0.22
31 0.18
32 0.16
33 0.13
34 0.13
35 0.09
36 0.05
37 0.06
38 0.08
39 0.08
40 0.09
41 0.09
42 0.11
43 0.12
44 0.15
45 0.16
46 0.19
47 0.2
48 0.22
49 0.22
50 0.2
51 0.19
52 0.16
53 0.15
54 0.12
55 0.1
56 0.09
57 0.09
58 0.1
59 0.11
60 0.09
61 0.1
62 0.09
63 0.1
64 0.12
65 0.11
66 0.13
67 0.12
68 0.14
69 0.13
70 0.15
71 0.16
72 0.15
73 0.18
74 0.15
75 0.17
76 0.16
77 0.16
78 0.16
79 0.14
80 0.13
81 0.11
82 0.1
83 0.1
84 0.1
85 0.1
86 0.1
87 0.1