Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SZM6

Protein Details
Accession A0A5N6SZM6    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-41LLWKIPWRISQPQKARQRKRLRSVDRVVDTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKASSPLFSGLLWKIPWRISQPQKARQRKRLRSVDRVVDTISAALARNGQKARSVDRWYREMPREEEMLPKDKYTLFDKKEKTYRKGIHSTLPLIVRLLQSLSTSHVTSLAWDVRTKTRIEWEARYWEYVSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.23
4 0.28
5 0.29
6 0.38
7 0.43
8 0.52
9 0.59
10 0.66
11 0.74
12 0.81
13 0.85
14 0.85
15 0.88
16 0.88
17 0.89
18 0.9
19 0.88
20 0.87
21 0.84
22 0.83
23 0.74
24 0.65
25 0.56
26 0.45
27 0.37
28 0.27
29 0.19
30 0.11
31 0.08
32 0.07
33 0.1
34 0.1
35 0.15
36 0.16
37 0.16
38 0.2
39 0.21
40 0.26
41 0.29
42 0.34
43 0.34
44 0.37
45 0.41
46 0.39
47 0.43
48 0.43
49 0.4
50 0.37
51 0.34
52 0.33
53 0.29
54 0.3
55 0.27
56 0.28
57 0.24
58 0.21
59 0.2
60 0.19
61 0.21
62 0.22
63 0.28
64 0.27
65 0.34
66 0.37
67 0.43
68 0.51
69 0.55
70 0.54
71 0.56
72 0.59
73 0.59
74 0.63
75 0.58
76 0.56
77 0.53
78 0.5
79 0.44
80 0.39
81 0.32
82 0.25
83 0.25
84 0.18
85 0.15
86 0.14
87 0.1
88 0.1
89 0.1
90 0.13
91 0.14
92 0.14
93 0.13
94 0.14
95 0.13
96 0.13
97 0.17
98 0.17
99 0.16
100 0.18
101 0.21
102 0.26
103 0.29
104 0.3
105 0.28
106 0.33
107 0.38
108 0.42
109 0.45
110 0.45
111 0.52
112 0.52
113 0.53