Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TBY7

Protein Details
Accession A0A5N6TBY7    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
25-53AQEPRDDERPTKKQRGRPRSKSAELKPSIHydrophilic
67-88PEAAPKRGTRRGRPKGSRGSLQBasic
NLS Segment(s)
PositionSequence
34-52PTKKQRGRPRSKSAELKPS
62-84APSKAPEAAPKRGTRRGRPKGSR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040349  Csm1/Pcs1  
Gene Ontology GO:0033551  C:monopolin complex  
Amino Acid Sequences MPPKRKAAAKLSNLTESDNEDATQAQEPRDDERPTKKQRGRPRSKSAELKPSIQSKNDTTAAPSKAPEAAPKRGTRRGRPKGSRGSLQSVNQELEEQKEPEEGEEVAGPHVPESAPASNDELVASQPATRSTRSAKSAKPTTTRGRRKATAEKQVKTDGEFQYTPRSTRQYKSPVKGNDEAEQSTKKRRKADPQFEPEEEVSEGEKAAPGVVEETFLQEEPVESRPISMSPAKRRQSTQRPLQSSPQKPNAEPELRRKIGELTKKYDTLESRYRTLKEIGVVEANANMEKLRKQCEAMTNGLWIPASPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.48
3 0.41
4 0.35
5 0.28
6 0.23
7 0.18
8 0.18
9 0.17
10 0.21
11 0.19
12 0.17
13 0.2
14 0.21
15 0.25
16 0.31
17 0.34
18 0.34
19 0.43
20 0.52
21 0.58
22 0.68
23 0.71
24 0.73
25 0.8
26 0.86
27 0.87
28 0.87
29 0.88
30 0.87
31 0.88
32 0.89
33 0.86
34 0.85
35 0.77
36 0.72
37 0.67
38 0.66
39 0.61
40 0.54
41 0.51
42 0.43
43 0.46
44 0.44
45 0.38
46 0.33
47 0.36
48 0.36
49 0.33
50 0.3
51 0.25
52 0.26
53 0.26
54 0.3
55 0.29
56 0.33
57 0.38
58 0.44
59 0.49
60 0.55
61 0.62
62 0.65
63 0.7
64 0.73
65 0.78
66 0.8
67 0.82
68 0.84
69 0.82
70 0.79
71 0.72
72 0.68
73 0.62
74 0.57
75 0.53
76 0.45
77 0.39
78 0.32
79 0.29
80 0.23
81 0.21
82 0.21
83 0.17
84 0.15
85 0.16
86 0.16
87 0.14
88 0.15
89 0.12
90 0.09
91 0.1
92 0.1
93 0.08
94 0.09
95 0.09
96 0.07
97 0.08
98 0.07
99 0.06
100 0.1
101 0.1
102 0.1
103 0.11
104 0.14
105 0.13
106 0.14
107 0.13
108 0.1
109 0.08
110 0.08
111 0.08
112 0.06
113 0.06
114 0.09
115 0.11
116 0.11
117 0.14
118 0.17
119 0.22
120 0.27
121 0.31
122 0.31
123 0.38
124 0.44
125 0.46
126 0.46
127 0.47
128 0.52
129 0.58
130 0.64
131 0.64
132 0.63
133 0.63
134 0.64
135 0.69
136 0.67
137 0.67
138 0.65
139 0.6
140 0.56
141 0.56
142 0.5
143 0.42
144 0.41
145 0.31
146 0.27
147 0.26
148 0.24
149 0.28
150 0.28
151 0.27
152 0.23
153 0.28
154 0.27
155 0.29
156 0.35
157 0.38
158 0.44
159 0.48
160 0.53
161 0.53
162 0.56
163 0.59
164 0.54
165 0.48
166 0.43
167 0.39
168 0.34
169 0.33
170 0.29
171 0.34
172 0.37
173 0.37
174 0.43
175 0.48
176 0.56
177 0.63
178 0.72
179 0.72
180 0.74
181 0.75
182 0.68
183 0.66
184 0.55
185 0.46
186 0.35
187 0.26
188 0.18
189 0.12
190 0.12
191 0.08
192 0.08
193 0.06
194 0.06
195 0.05
196 0.04
197 0.05
198 0.05
199 0.06
200 0.06
201 0.08
202 0.09
203 0.09
204 0.09
205 0.07
206 0.08
207 0.09
208 0.11
209 0.11
210 0.1
211 0.11
212 0.12
213 0.12
214 0.16
215 0.2
216 0.25
217 0.34
218 0.44
219 0.49
220 0.52
221 0.56
222 0.63
223 0.68
224 0.7
225 0.7
226 0.7
227 0.71
228 0.72
229 0.76
230 0.76
231 0.73
232 0.72
233 0.71
234 0.65
235 0.6
236 0.62
237 0.62
238 0.6
239 0.57
240 0.58
241 0.59
242 0.57
243 0.57
244 0.52
245 0.5
246 0.5
247 0.54
248 0.51
249 0.47
250 0.51
251 0.52
252 0.52
253 0.51
254 0.46
255 0.44
256 0.47
257 0.44
258 0.44
259 0.47
260 0.48
261 0.45
262 0.45
263 0.4
264 0.35
265 0.33
266 0.31
267 0.28
268 0.27
269 0.24
270 0.22
271 0.21
272 0.16
273 0.14
274 0.12
275 0.12
276 0.16
277 0.2
278 0.25
279 0.27
280 0.29
281 0.35
282 0.43
283 0.46
284 0.46
285 0.44
286 0.41
287 0.38
288 0.37
289 0.31