Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SS12

Protein Details
Accession A0A5N6SS12   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
112-131NKCVDGLCRRVKKEKRTVMFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, cyto 2, E.R. 2, golg 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MYISKKLSLLSIPFVLGGVAAAGGCGDADACIGTEYCTTATFTTPTATTITTCVPTPTCLGVYADCVSGGGGPVCCSTYCAATKCRPTDPKWPGCSEDLGVCLADENCCYNNKCVDGLCRRVKKEKRTVMF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.12
4 0.09
5 0.05
6 0.04
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.02
13 0.02
14 0.02
15 0.03
16 0.03
17 0.03
18 0.04
19 0.04
20 0.05
21 0.05
22 0.06
23 0.07
24 0.08
25 0.08
26 0.08
27 0.1
28 0.1
29 0.1
30 0.11
31 0.1
32 0.11
33 0.11
34 0.11
35 0.1
36 0.11
37 0.11
38 0.11
39 0.11
40 0.11
41 0.1
42 0.11
43 0.12
44 0.11
45 0.1
46 0.1
47 0.1
48 0.1
49 0.11
50 0.11
51 0.09
52 0.08
53 0.08
54 0.07
55 0.06
56 0.06
57 0.04
58 0.04
59 0.04
60 0.05
61 0.06
62 0.06
63 0.07
64 0.07
65 0.1
66 0.12
67 0.14
68 0.18
69 0.23
70 0.29
71 0.31
72 0.38
73 0.41
74 0.43
75 0.51
76 0.56
77 0.6
78 0.59
79 0.59
80 0.54
81 0.51
82 0.48
83 0.38
84 0.3
85 0.22
86 0.18
87 0.15
88 0.12
89 0.12
90 0.1
91 0.09
92 0.09
93 0.1
94 0.11
95 0.14
96 0.17
97 0.19
98 0.22
99 0.24
100 0.25
101 0.24
102 0.32
103 0.37
104 0.44
105 0.51
106 0.55
107 0.59
108 0.68
109 0.75
110 0.77
111 0.79