Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SE21

Protein Details
Accession A0A5N6SE21    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
423-453ASPSARRRVHRRTSSHGHLRRRQPVKRTFVSHydrophilic
NLS Segment(s)
PositionSequence
286-288RKR
428-444RRRVHRRTSSHGHLRRR
Subcellular Location(s) nucl 10, mito 9.5, cyto_mito 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003781  CoA-bd  
IPR036291  NAD(P)-bd_dom_sf  
Pfam View protein in Pfam  
PF13380  CoA_binding_2  
Amino Acid Sequences MEAVKRFFSSPRFAVAGASNDSNKFGYKILAWYHQHSLPVTPLNPRAPKIELPSHAYDTVASPRALTAPSQTSLSVVTAPAVTLPLLQEAHAVGIPAVWLQPGTFDDAVLEFARKHFPAVIAGDGGAGSEGWCVLVDGEEGLEAAGVQWTSQKLKIKIKCNTLLDKGKEMPTSSFVLDSPIPPQLDLAGAPSQLFLPPNPSASSALFRSISIPSRKRARGVESGHRSWLDSPSSPTSFTVADDRLAGVDDVSAEHDYRPSRYRDPPLRLPLDSSVESLSDASGARRKRSRRDPSSVVAPSPSGPEDEKVTQDNSYYPQTAPVRWSRAVLDVVGKVWDFCWSGAFRGFYAGGGRGYSMTAGDPSVSLGPDDHSWQPTTEKHDLSSASAGTHGWAEPTPFSDDHHDDDLHHNWVVVGRDEFGYEASPSARRRVHRRTSSHGHLRRRQPVKRTFVSQPASITTKSHFAAPAKPRETPVSVETQRYMAQKRRMEREEDASLARLNRQLQAMIKEGKQALGTRVEVDDFMED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.34
4 0.29
5 0.3
6 0.28
7 0.26
8 0.28
9 0.26
10 0.24
11 0.2
12 0.18
13 0.17
14 0.17
15 0.22
16 0.24
17 0.33
18 0.35
19 0.38
20 0.42
21 0.42
22 0.43
23 0.38
24 0.36
25 0.32
26 0.34
27 0.31
28 0.32
29 0.36
30 0.41
31 0.45
32 0.44
33 0.44
34 0.42
35 0.45
36 0.47
37 0.49
38 0.45
39 0.47
40 0.5
41 0.5
42 0.46
43 0.41
44 0.35
45 0.29
46 0.31
47 0.28
48 0.23
49 0.18
50 0.19
51 0.2
52 0.2
53 0.18
54 0.17
55 0.18
56 0.2
57 0.21
58 0.2
59 0.19
60 0.19
61 0.19
62 0.15
63 0.11
64 0.1
65 0.09
66 0.09
67 0.09
68 0.08
69 0.07
70 0.07
71 0.07
72 0.09
73 0.1
74 0.1
75 0.1
76 0.1
77 0.11
78 0.11
79 0.1
80 0.07
81 0.07
82 0.07
83 0.06
84 0.06
85 0.05
86 0.05
87 0.04
88 0.06
89 0.07
90 0.12
91 0.12
92 0.11
93 0.12
94 0.12
95 0.15
96 0.13
97 0.14
98 0.09
99 0.11
100 0.15
101 0.15
102 0.15
103 0.15
104 0.16
105 0.19
106 0.2
107 0.2
108 0.16
109 0.16
110 0.15
111 0.12
112 0.11
113 0.07
114 0.05
115 0.04
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.04
135 0.06
136 0.08
137 0.1
138 0.15
139 0.22
140 0.27
141 0.37
142 0.44
143 0.51
144 0.57
145 0.63
146 0.66
147 0.64
148 0.64
149 0.62
150 0.63
151 0.56
152 0.54
153 0.49
154 0.45
155 0.41
156 0.37
157 0.3
158 0.25
159 0.25
160 0.2
161 0.18
162 0.15
163 0.16
164 0.15
165 0.15
166 0.13
167 0.15
168 0.15
169 0.14
170 0.14
171 0.11
172 0.11
173 0.1
174 0.11
175 0.08
176 0.08
177 0.09
178 0.09
179 0.09
180 0.09
181 0.1
182 0.07
183 0.11
184 0.11
185 0.13
186 0.14
187 0.15
188 0.16
189 0.17
190 0.19
191 0.15
192 0.17
193 0.16
194 0.15
195 0.15
196 0.16
197 0.21
198 0.26
199 0.28
200 0.31
201 0.39
202 0.4
203 0.42
204 0.44
205 0.43
206 0.44
207 0.47
208 0.52
209 0.51
210 0.51
211 0.49
212 0.45
213 0.4
214 0.33
215 0.31
216 0.23
217 0.17
218 0.19
219 0.21
220 0.22
221 0.21
222 0.2
223 0.19
224 0.16
225 0.16
226 0.16
227 0.12
228 0.11
229 0.11
230 0.11
231 0.09
232 0.09
233 0.08
234 0.05
235 0.04
236 0.04
237 0.04
238 0.05
239 0.06
240 0.05
241 0.06
242 0.08
243 0.09
244 0.11
245 0.15
246 0.17
247 0.22
248 0.27
249 0.36
250 0.41
251 0.48
252 0.53
253 0.56
254 0.55
255 0.5
256 0.47
257 0.4
258 0.36
259 0.3
260 0.23
261 0.16
262 0.13
263 0.13
264 0.12
265 0.09
266 0.06
267 0.06
268 0.06
269 0.1
270 0.12
271 0.16
272 0.22
273 0.26
274 0.35
275 0.46
276 0.55
277 0.59
278 0.66
279 0.67
280 0.64
281 0.68
282 0.61
283 0.5
284 0.4
285 0.32
286 0.25
287 0.21
288 0.18
289 0.1
290 0.1
291 0.1
292 0.13
293 0.14
294 0.15
295 0.15
296 0.16
297 0.15
298 0.15
299 0.15
300 0.15
301 0.16
302 0.16
303 0.14
304 0.2
305 0.21
306 0.22
307 0.25
308 0.27
309 0.29
310 0.28
311 0.29
312 0.24
313 0.26
314 0.25
315 0.22
316 0.19
317 0.14
318 0.14
319 0.14
320 0.12
321 0.09
322 0.09
323 0.1
324 0.09
325 0.08
326 0.11
327 0.11
328 0.13
329 0.15
330 0.16
331 0.13
332 0.14
333 0.15
334 0.12
335 0.13
336 0.13
337 0.1
338 0.1
339 0.1
340 0.08
341 0.08
342 0.08
343 0.07
344 0.06
345 0.06
346 0.06
347 0.06
348 0.05
349 0.06
350 0.07
351 0.07
352 0.07
353 0.06
354 0.08
355 0.09
356 0.12
357 0.13
358 0.14
359 0.15
360 0.16
361 0.19
362 0.2
363 0.27
364 0.3
365 0.28
366 0.27
367 0.3
368 0.3
369 0.28
370 0.27
371 0.2
372 0.15
373 0.15
374 0.14
375 0.11
376 0.11
377 0.09
378 0.08
379 0.08
380 0.09
381 0.09
382 0.11
383 0.15
384 0.14
385 0.16
386 0.21
387 0.23
388 0.25
389 0.28
390 0.26
391 0.24
392 0.29
393 0.3
394 0.26
395 0.24
396 0.2
397 0.17
398 0.2
399 0.19
400 0.17
401 0.15
402 0.13
403 0.13
404 0.14
405 0.14
406 0.11
407 0.11
408 0.09
409 0.09
410 0.1
411 0.15
412 0.16
413 0.23
414 0.27
415 0.32
416 0.42
417 0.51
418 0.6
419 0.65
420 0.7
421 0.73
422 0.77
423 0.81
424 0.82
425 0.8
426 0.8
427 0.79
428 0.82
429 0.83
430 0.83
431 0.81
432 0.8
433 0.81
434 0.8
435 0.77
436 0.74
437 0.7
438 0.69
439 0.66
440 0.59
441 0.51
442 0.46
443 0.44
444 0.38
445 0.34
446 0.26
447 0.27
448 0.25
449 0.26
450 0.26
451 0.25
452 0.34
453 0.4
454 0.48
455 0.46
456 0.48
457 0.49
458 0.49
459 0.5
460 0.45
461 0.4
462 0.4
463 0.39
464 0.41
465 0.39
466 0.36
467 0.38
468 0.39
469 0.43
470 0.41
471 0.48
472 0.51
473 0.58
474 0.65
475 0.66
476 0.66
477 0.65
478 0.64
479 0.6
480 0.56
481 0.5
482 0.42
483 0.4
484 0.35
485 0.32
486 0.29
487 0.26
488 0.27
489 0.27
490 0.28
491 0.3
492 0.33
493 0.36
494 0.37
495 0.36
496 0.39
497 0.37
498 0.36
499 0.34
500 0.33
501 0.3
502 0.31
503 0.31
504 0.27
505 0.27
506 0.26
507 0.23