Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6TCQ8

Protein Details
Accession A0A5N6TCQ8    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-65PTDPPRLSGKTNRKREKKRRQVNEEEDRVREBasic
NLS Segment(s)
PositionSequence
40-54RLSGKTNRKREKKRR
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
Amino Acid Sequences MRSERHPIDFVKNVSYVAWRRSLVARGMSVRLRVPTDPPRLSGKTNRKREKKRRQVNEEEDRVRERQVYQFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.28
4 0.24
5 0.26
6 0.23
7 0.24
8 0.27
9 0.29
10 0.26
11 0.25
12 0.25
13 0.22
14 0.25
15 0.24
16 0.23
17 0.21
18 0.19
19 0.18
20 0.17
21 0.2
22 0.25
23 0.31
24 0.3
25 0.31
26 0.36
27 0.36
28 0.39
29 0.44
30 0.47
31 0.5
32 0.6
33 0.68
34 0.72
35 0.82
36 0.89
37 0.91
38 0.91
39 0.92
40 0.92
41 0.92
42 0.93
43 0.92
44 0.91
45 0.89
46 0.81
47 0.75
48 0.68
49 0.59
50 0.5
51 0.43
52 0.36