Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SDA0

Protein Details
Accession A0A5N6SDA0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-85SKEAKKEKKSHISKSPSKSCFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8extr 8, E.R. 5, plas 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MIPPIISPPSSLPHVPPLSCFLYLLCPCLLPVCSSPVEFRDFDFPSKILGLLSPWTADLTYAGDSKEAKKEKKSHISKSPSKSCFHNHIHVMPLCLIPPPNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.3
4 0.31
5 0.3
6 0.29
7 0.27
8 0.19
9 0.23
10 0.23
11 0.24
12 0.19
13 0.16
14 0.16
15 0.17
16 0.17
17 0.11
18 0.12
19 0.13
20 0.14
21 0.15
22 0.16
23 0.16
24 0.19
25 0.17
26 0.17
27 0.19
28 0.2
29 0.2
30 0.21
31 0.19
32 0.17
33 0.17
34 0.16
35 0.1
36 0.08
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.05
46 0.06
47 0.07
48 0.07
49 0.07
50 0.08
51 0.09
52 0.11
53 0.19
54 0.24
55 0.26
56 0.33
57 0.41
58 0.5
59 0.6
60 0.66
61 0.67
62 0.71
63 0.78
64 0.79
65 0.8
66 0.81
67 0.74
68 0.69
69 0.65
70 0.61
71 0.61
72 0.58
73 0.56
74 0.51
75 0.5
76 0.55
77 0.51
78 0.47
79 0.4
80 0.34
81 0.27
82 0.24