Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6T9I5

Protein Details
Accession A0A5N6T9I5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-39PPPFYHEKEKKKKIMEKRKIBasic
NLS Segment(s)
PositionSequence
27-38KEKKKKIMEKRK
Subcellular Location(s) plas 14, E.R. 4, mito 3, golg 3, pero 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MPMIVSLFFLLSIVDAHIYPPPFYHEKEKKKKIMEKRKIYVQRKSFLFFLYNNRQLCHIVLLSPKGPTSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.1
5 0.11
6 0.1
7 0.11
8 0.15
9 0.17
10 0.2
11 0.29
12 0.36
13 0.46
14 0.57
15 0.65
16 0.67
17 0.72
18 0.78
19 0.79
20 0.8
21 0.8
22 0.79
23 0.75
24 0.78
25 0.8
26 0.78
27 0.76
28 0.71
29 0.67
30 0.6
31 0.59
32 0.5
33 0.41
34 0.37
35 0.3
36 0.33
37 0.35
38 0.4
39 0.38
40 0.37
41 0.38
42 0.36
43 0.35
44 0.3
45 0.21
46 0.18
47 0.21
48 0.24
49 0.24
50 0.24