Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6SD13

Protein Details
Accession A0A5N6SD13    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MKVWRDWTPRKENWRREKKIKIRVALTHydrophilic
NLS Segment(s)
PositionSequence
15-19RREKK
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
Amino Acid Sequences MKVWRDWTPRKENWRREKKIKIRVALTTGLGLVMHEHLPILTLGHVKWIAKREYEVVPGIEPGLQESESWVLTITLHNQLLLWLLEFLVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.87
4 0.9
5 0.89
6 0.89
7 0.86
8 0.82
9 0.75
10 0.69
11 0.63
12 0.54
13 0.45
14 0.35
15 0.26
16 0.19
17 0.15
18 0.11
19 0.07
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.07
32 0.08
33 0.08
34 0.11
35 0.15
36 0.16
37 0.16
38 0.17
39 0.18
40 0.19
41 0.22
42 0.2
43 0.16
44 0.15
45 0.15
46 0.14
47 0.12
48 0.1
49 0.08
50 0.09
51 0.08
52 0.08
53 0.09
54 0.1
55 0.09
56 0.1
57 0.09
58 0.07
59 0.08
60 0.09
61 0.11
62 0.15
63 0.15
64 0.15
65 0.15
66 0.15
67 0.16
68 0.15
69 0.13
70 0.08