Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SL29

Protein Details
Accession A0A5N6SL29    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
105-126TSLKRFCDIKALQRKQRRKTHQHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 6, extr 2, E.R. 2, cyto 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIRNIRFTILNFMSQLHRHEHGIPSPRKSCSNANFASTLHCSSSLFRRVYALKTFVWNSRCSLVVFCCSFFWVVVYLDLFLSVVFWKLCFFGACKIADCRSLSLTSLKRFCDIKALQRKQRRKTHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.26
4 0.26
5 0.26
6 0.28
7 0.31
8 0.33
9 0.41
10 0.43
11 0.46
12 0.48
13 0.49
14 0.49
15 0.49
16 0.51
17 0.47
18 0.5
19 0.45
20 0.43
21 0.41
22 0.38
23 0.38
24 0.31
25 0.26
26 0.18
27 0.17
28 0.15
29 0.15
30 0.22
31 0.25
32 0.23
33 0.22
34 0.24
35 0.26
36 0.29
37 0.3
38 0.26
39 0.2
40 0.23
41 0.24
42 0.26
43 0.26
44 0.24
45 0.22
46 0.2
47 0.21
48 0.18
49 0.17
50 0.14
51 0.15
52 0.15
53 0.14
54 0.13
55 0.12
56 0.12
57 0.11
58 0.1
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.06
67 0.04
68 0.05
69 0.04
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.07
76 0.08
77 0.09
78 0.12
79 0.16
80 0.17
81 0.19
82 0.21
83 0.22
84 0.26
85 0.26
86 0.24
87 0.22
88 0.22
89 0.22
90 0.26
91 0.31
92 0.34
93 0.37
94 0.36
95 0.37
96 0.37
97 0.36
98 0.39
99 0.37
100 0.4
101 0.47
102 0.56
103 0.62
104 0.71
105 0.81
106 0.81