Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5M3Q0

Protein Details
Accession C5M3Q0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
91-126EEPPSRQPKPRHPPFPKPHRRHHGRHQRPKNYPPPPBasic
NLS Segment(s)
PositionSequence
96-128RQPKPRHPPFPKPHRRHHGRHQRPKNYPPPPPP
Subcellular Location(s) cyto_nucl 14, cyto 11.5, nucl 9.5, mito 6
Family & Domain DBs
KEGG ctp:CTRG_00689  -  
Amino Acid Sequences MVDANIINNKKRRTEIGADEIESIYIDDEIIQIYLKKKGLSADGHAPPHHPPHHHHHYDHHEHYDRDEILSLSEDDEPGTPSGNESDSDHEEPPSRQPKPRHPPFPKPHRRHHGRHQRPKNYPPPPPPPPPHHFSGHHHGSYPPPPLPPPPPFYHGEHGFPGYGSAPPPPPPPPPFNHGERGFPGYGSAPPPPPPPPPPFHHQSGNYGGYPYPPPPPPPPGQHHGYPDEEYYSSSKPPMYRGHGTCSCQKDHFNYYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.58
4 0.57
5 0.53
6 0.51
7 0.45
8 0.37
9 0.29
10 0.21
11 0.13
12 0.08
13 0.07
14 0.05
15 0.05
16 0.06
17 0.06
18 0.06
19 0.08
20 0.1
21 0.15
22 0.17
23 0.17
24 0.18
25 0.21
26 0.27
27 0.28
28 0.31
29 0.35
30 0.39
31 0.42
32 0.41
33 0.4
34 0.37
35 0.42
36 0.41
37 0.35
38 0.34
39 0.41
40 0.51
41 0.55
42 0.54
43 0.54
44 0.59
45 0.65
46 0.64
47 0.62
48 0.56
49 0.51
50 0.51
51 0.48
52 0.39
53 0.31
54 0.28
55 0.2
56 0.16
57 0.17
58 0.16
59 0.11
60 0.11
61 0.1
62 0.09
63 0.09
64 0.1
65 0.09
66 0.09
67 0.08
68 0.08
69 0.09
70 0.1
71 0.1
72 0.1
73 0.14
74 0.17
75 0.2
76 0.2
77 0.2
78 0.21
79 0.21
80 0.28
81 0.32
82 0.31
83 0.35
84 0.41
85 0.51
86 0.6
87 0.68
88 0.71
89 0.71
90 0.79
91 0.82
92 0.88
93 0.88
94 0.84
95 0.84
96 0.84
97 0.85
98 0.81
99 0.82
100 0.82
101 0.82
102 0.86
103 0.86
104 0.85
105 0.84
106 0.85
107 0.84
108 0.8
109 0.77
110 0.73
111 0.71
112 0.68
113 0.68
114 0.65
115 0.62
116 0.6
117 0.56
118 0.52
119 0.48
120 0.45
121 0.42
122 0.45
123 0.43
124 0.38
125 0.35
126 0.33
127 0.31
128 0.31
129 0.3
130 0.22
131 0.18
132 0.19
133 0.22
134 0.26
135 0.27
136 0.29
137 0.28
138 0.31
139 0.33
140 0.36
141 0.4
142 0.36
143 0.35
144 0.31
145 0.29
146 0.25
147 0.21
148 0.18
149 0.12
150 0.11
151 0.09
152 0.1
153 0.1
154 0.12
155 0.15
156 0.17
157 0.23
158 0.26
159 0.31
160 0.32
161 0.36
162 0.38
163 0.4
164 0.45
165 0.41
166 0.4
167 0.38
168 0.39
169 0.34
170 0.3
171 0.26
172 0.19
173 0.19
174 0.18
175 0.18
176 0.14
177 0.16
178 0.19
179 0.21
180 0.25
181 0.29
182 0.33
183 0.36
184 0.4
185 0.45
186 0.48
187 0.5
188 0.52
189 0.49
190 0.48
191 0.49
192 0.48
193 0.41
194 0.37
195 0.32
196 0.27
197 0.27
198 0.23
199 0.22
200 0.21
201 0.26
202 0.29
203 0.36
204 0.4
205 0.45
206 0.5
207 0.51
208 0.53
209 0.54
210 0.55
211 0.52
212 0.5
213 0.44
214 0.39
215 0.36
216 0.31
217 0.28
218 0.26
219 0.24
220 0.22
221 0.21
222 0.23
223 0.22
224 0.27
225 0.33
226 0.37
227 0.44
228 0.46
229 0.53
230 0.57
231 0.59
232 0.61
233 0.59
234 0.56
235 0.51
236 0.53
237 0.5