Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6T830

Protein Details
Accession A0A5N6T830   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
32-55FQGMYKRHAGRKKRSRREGQGLDPBasic
NLS Segment(s)
PositionSequence
37-48KRHAGRKKRSRR
Subcellular Location(s) plas 10, mito 6.5, cyto_mito 4, nucl 3, golg 3, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MTLKAETRHASCHKSDRLILSILQHDDRWKDFQGMYKRHAGRKKRSRREGQGLDPGSGSVVIMTFLVVFGKKGLIRFWSFLGSELHLLYHPFVIDSELPFFPFVDEIVDPTTFFPEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.47
4 0.45
5 0.42
6 0.38
7 0.32
8 0.31
9 0.29
10 0.27
11 0.24
12 0.23
13 0.24
14 0.26
15 0.26
16 0.22
17 0.23
18 0.23
19 0.3
20 0.37
21 0.38
22 0.39
23 0.45
24 0.47
25 0.51
26 0.58
27 0.59
28 0.61
29 0.67
30 0.75
31 0.77
32 0.83
33 0.85
34 0.86
35 0.87
36 0.83
37 0.77
38 0.75
39 0.65
40 0.56
41 0.46
42 0.37
43 0.26
44 0.19
45 0.14
46 0.05
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.06
58 0.07
59 0.08
60 0.09
61 0.12
62 0.14
63 0.16
64 0.17
65 0.18
66 0.17
67 0.18
68 0.19
69 0.16
70 0.15
71 0.14
72 0.13
73 0.11
74 0.11
75 0.1
76 0.09
77 0.08
78 0.07
79 0.07
80 0.1
81 0.1
82 0.11
83 0.14
84 0.14
85 0.15
86 0.15
87 0.15
88 0.13
89 0.12
90 0.11
91 0.1
92 0.1
93 0.11
94 0.14
95 0.14
96 0.14
97 0.14