Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6T982

Protein Details
Accession A0A5N6T982    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-104VGMHGISRRQERKREPNYLKVGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, extr 5, cyto 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTRANMFILYSASSRNVTLSPRSGRGRFPPVPKLVSQVPLPGTINAGLAFRLHPGAPLNAKIAYSVIAGVVGLAYLGVHLLVGMHGISRRQERKREPNYLKVGSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.17
5 0.2
6 0.25
7 0.27
8 0.33
9 0.39
10 0.39
11 0.41
12 0.45
13 0.5
14 0.5
15 0.51
16 0.53
17 0.51
18 0.52
19 0.48
20 0.46
21 0.39
22 0.36
23 0.3
24 0.25
25 0.22
26 0.21
27 0.22
28 0.17
29 0.16
30 0.13
31 0.13
32 0.1
33 0.09
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.09
43 0.1
44 0.11
45 0.12
46 0.11
47 0.11
48 0.11
49 0.1
50 0.09
51 0.08
52 0.07
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.03
70 0.03
71 0.04
72 0.05
73 0.07
74 0.11
75 0.2
76 0.29
77 0.36
78 0.45
79 0.55
80 0.65
81 0.73
82 0.8
83 0.79
84 0.8
85 0.82
86 0.78