Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6T414

Protein Details
Accession A0A5N6T414   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
93-123YKRARYLTLLTRRRRRRMSRKQREILERDPWHydrophilic
NLS Segment(s)
PositionSequence
104-115RRRRRRMSRKQR
Subcellular Location(s) mito 22, nucl 2, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MRWPKPIIHPKASLQRLSLWFSKISSGSLCHTIWHFRKTLRYIELYNITLSGGATWEEPMWVICHCPLLSYVKLGGCDPTVDCQTVWGVRSEYKRARYLTLLTRRRRRRMSRKQREILERDPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.48
4 0.48
5 0.43
6 0.35
7 0.31
8 0.29
9 0.31
10 0.24
11 0.22
12 0.18
13 0.17
14 0.18
15 0.21
16 0.2
17 0.18
18 0.19
19 0.26
20 0.28
21 0.3
22 0.3
23 0.28
24 0.35
25 0.37
26 0.41
27 0.37
28 0.36
29 0.34
30 0.36
31 0.37
32 0.31
33 0.28
34 0.22
35 0.18
36 0.15
37 0.13
38 0.09
39 0.05
40 0.04
41 0.04
42 0.05
43 0.05
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.07
52 0.07
53 0.07
54 0.08
55 0.11
56 0.11
57 0.12
58 0.13
59 0.13
60 0.13
61 0.13
62 0.13
63 0.1
64 0.1
65 0.1
66 0.11
67 0.12
68 0.12
69 0.11
70 0.11
71 0.13
72 0.13
73 0.13
74 0.12
75 0.12
76 0.16
77 0.21
78 0.27
79 0.32
80 0.36
81 0.41
82 0.41
83 0.43
84 0.42
85 0.44
86 0.46
87 0.5
88 0.54
89 0.58
90 0.66
91 0.73
92 0.79
93 0.84
94 0.86
95 0.86
96 0.89
97 0.91
98 0.92
99 0.94
100 0.93
101 0.92
102 0.91
103 0.87