Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6SVC1

Protein Details
Accession A0A5N6SVC1    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
2-21NWSPRSKTYKRERSNFMGSEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MNWSPRSKTYKRERSNFMGSEFGLHFGTESKLQNWQALCRELQIDIPMASITQCRKALARVHVNLVDLIDSRRTGTAIKTFSSLSALRVYTLDSGKVFPKNAAKRDGFLKDLLRRIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.73
4 0.64
5 0.56
6 0.47
7 0.42
8 0.34
9 0.28
10 0.2
11 0.16
12 0.14
13 0.12
14 0.14
15 0.14
16 0.15
17 0.14
18 0.19
19 0.21
20 0.24
21 0.23
22 0.26
23 0.26
24 0.26
25 0.25
26 0.21
27 0.21
28 0.18
29 0.18
30 0.15
31 0.12
32 0.1
33 0.1
34 0.08
35 0.08
36 0.07
37 0.09
38 0.09
39 0.12
40 0.13
41 0.13
42 0.13
43 0.17
44 0.22
45 0.26
46 0.32
47 0.29
48 0.31
49 0.31
50 0.31
51 0.28
52 0.22
53 0.16
54 0.1
55 0.09
56 0.08
57 0.07
58 0.07
59 0.07
60 0.08
61 0.08
62 0.1
63 0.15
64 0.16
65 0.17
66 0.18
67 0.18
68 0.17
69 0.2
70 0.18
71 0.14
72 0.16
73 0.15
74 0.15
75 0.15
76 0.16
77 0.15
78 0.16
79 0.16
80 0.13
81 0.15
82 0.18
83 0.21
84 0.21
85 0.22
86 0.31
87 0.37
88 0.42
89 0.48
90 0.46
91 0.46
92 0.52
93 0.53
94 0.46
95 0.42
96 0.45
97 0.43